Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QUL4

Protein Details
Accession A0A5B1QUL4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
603-639VRIYSDKESKRGKSQPRKSKAPKSKSCKPTARVSPSDHydrophilic
NLS Segment(s)
PositionSequence
611-627SKRGKSQPRKSKAPKSK
Subcellular Location(s) mito 20.5, cyto_mito 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFKNPPHSARLLQPTPFSVPFNFAAMPLTRSSHSRATAPPVGSSPGRMWPPALARLKSKLKAKPFISSYNQDTGKIDCIGFPASETGEAIPALGNDLLQYRQSHDWPLPYCFCGSVTGVPTRCRLFIPTSGNYAGMACLTCEEQECLYWINLATLYEDHTGLPKEHYPPLPVPPTTAPAGSANAPTGGVNLPAGAADAPACGVDLPAGAAEAPAGGVGLPIADANIPAGEAGALASEGEMLPPPPSQYTLRSGCPSAPPSPLTPLNAHTSAALLVKMEVDQQEVDIFGEWDVFSQDPPMPSLFSSRHLTRSSSGAPIGDEGCYAEDLTWLHDDDVPALLAGRLVQDMPPLTPAVSMEMCARMFQGPGIKFQELIHLLRKCYKCSRIMTSDIVQSHNCPAGKTSSTLLLSSTSTPAPPVVGPSNSAPDAVPASLPSTPVPGGSAFAAYQTPTHQPSMPSVGTLRTESRELSCFPLTPFPMMGPSEGVVTPVRSSSIPSPGTSLASRQSDSAVVLRHRTATPPTPLAPAKPRKVVMRSLSQHPIAFSGILIKDLTQVGQKKEAGKGGRSSNTGCLRFVDKGKGKEVVNQKGNDGSRQGSVDSDVVRIYSDKESKRGKSQPRKSKAPKSKSCKPTARVSPSDLIDLTLDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.47
4 0.41
5 0.33
6 0.32
7 0.3
8 0.3
9 0.27
10 0.21
11 0.22
12 0.21
13 0.22
14 0.2
15 0.21
16 0.19
17 0.22
18 0.27
19 0.3
20 0.31
21 0.33
22 0.35
23 0.4
24 0.46
25 0.44
26 0.41
27 0.36
28 0.38
29 0.34
30 0.34
31 0.28
32 0.28
33 0.29
34 0.27
35 0.26
36 0.27
37 0.32
38 0.38
39 0.43
40 0.39
41 0.41
42 0.49
43 0.57
44 0.58
45 0.62
46 0.61
47 0.62
48 0.69
49 0.67
50 0.67
51 0.64
52 0.66
53 0.65
54 0.63
55 0.59
56 0.58
57 0.56
58 0.49
59 0.45
60 0.39
61 0.35
62 0.31
63 0.26
64 0.18
65 0.19
66 0.19
67 0.18
68 0.16
69 0.14
70 0.12
71 0.13
72 0.13
73 0.11
74 0.1
75 0.1
76 0.09
77 0.08
78 0.07
79 0.09
80 0.08
81 0.07
82 0.07
83 0.09
84 0.09
85 0.12
86 0.13
87 0.15
88 0.19
89 0.21
90 0.25
91 0.26
92 0.32
93 0.32
94 0.38
95 0.36
96 0.34
97 0.33
98 0.29
99 0.27
100 0.23
101 0.22
102 0.2
103 0.21
104 0.25
105 0.27
106 0.29
107 0.32
108 0.31
109 0.3
110 0.27
111 0.27
112 0.25
113 0.3
114 0.35
115 0.34
116 0.37
117 0.36
118 0.35
119 0.32
120 0.28
121 0.21
122 0.14
123 0.11
124 0.07
125 0.07
126 0.07
127 0.07
128 0.08
129 0.1
130 0.09
131 0.1
132 0.11
133 0.12
134 0.12
135 0.12
136 0.11
137 0.11
138 0.11
139 0.11
140 0.11
141 0.09
142 0.12
143 0.12
144 0.12
145 0.11
146 0.13
147 0.14
148 0.14
149 0.16
150 0.17
151 0.2
152 0.25
153 0.27
154 0.28
155 0.29
156 0.35
157 0.38
158 0.34
159 0.34
160 0.3
161 0.32
162 0.29
163 0.26
164 0.21
165 0.17
166 0.19
167 0.17
168 0.15
169 0.13
170 0.12
171 0.12
172 0.1
173 0.1
174 0.09
175 0.08
176 0.07
177 0.06
178 0.06
179 0.05
180 0.06
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.02
222 0.02
223 0.03
224 0.03
225 0.03
226 0.03
227 0.04
228 0.05
229 0.05
230 0.07
231 0.07
232 0.1
233 0.11
234 0.14
235 0.2
236 0.23
237 0.25
238 0.26
239 0.27
240 0.25
241 0.28
242 0.28
243 0.24
244 0.24
245 0.22
246 0.22
247 0.25
248 0.26
249 0.24
250 0.22
251 0.22
252 0.24
253 0.23
254 0.22
255 0.17
256 0.16
257 0.14
258 0.13
259 0.11
260 0.06
261 0.06
262 0.06
263 0.06
264 0.07
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.05
273 0.05
274 0.04
275 0.05
276 0.04
277 0.04
278 0.05
279 0.05
280 0.05
281 0.06
282 0.08
283 0.08
284 0.09
285 0.09
286 0.09
287 0.09
288 0.13
289 0.12
290 0.15
291 0.19
292 0.19
293 0.23
294 0.24
295 0.25
296 0.23
297 0.25
298 0.23
299 0.2
300 0.19
301 0.15
302 0.14
303 0.13
304 0.13
305 0.09
306 0.07
307 0.06
308 0.06
309 0.06
310 0.05
311 0.04
312 0.05
313 0.05
314 0.06
315 0.07
316 0.07
317 0.07
318 0.08
319 0.08
320 0.08
321 0.09
322 0.07
323 0.06
324 0.06
325 0.05
326 0.04
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.06
334 0.06
335 0.07
336 0.06
337 0.06
338 0.06
339 0.06
340 0.08
341 0.07
342 0.08
343 0.08
344 0.1
345 0.1
346 0.09
347 0.1
348 0.08
349 0.08
350 0.08
351 0.14
352 0.12
353 0.17
354 0.2
355 0.19
356 0.19
357 0.2
358 0.24
359 0.2
360 0.22
361 0.25
362 0.23
363 0.24
364 0.31
365 0.32
366 0.31
367 0.35
368 0.38
369 0.38
370 0.41
371 0.47
372 0.43
373 0.46
374 0.46
375 0.41
376 0.41
377 0.36
378 0.33
379 0.26
380 0.23
381 0.21
382 0.21
383 0.19
384 0.15
385 0.15
386 0.17
387 0.18
388 0.18
389 0.17
390 0.17
391 0.18
392 0.18
393 0.17
394 0.15
395 0.14
396 0.14
397 0.15
398 0.1
399 0.1
400 0.1
401 0.1
402 0.09
403 0.08
404 0.11
405 0.12
406 0.12
407 0.14
408 0.15
409 0.18
410 0.17
411 0.17
412 0.14
413 0.12
414 0.13
415 0.11
416 0.1
417 0.07
418 0.09
419 0.09
420 0.1
421 0.09
422 0.1
423 0.1
424 0.1
425 0.1
426 0.09
427 0.09
428 0.09
429 0.09
430 0.07
431 0.08
432 0.08
433 0.07
434 0.08
435 0.09
436 0.12
437 0.14
438 0.16
439 0.17
440 0.18
441 0.2
442 0.26
443 0.24
444 0.21
445 0.2
446 0.2
447 0.2
448 0.21
449 0.2
450 0.16
451 0.17
452 0.17
453 0.19
454 0.19
455 0.19
456 0.22
457 0.22
458 0.21
459 0.21
460 0.26
461 0.24
462 0.23
463 0.22
464 0.17
465 0.19
466 0.18
467 0.18
468 0.13
469 0.12
470 0.12
471 0.12
472 0.13
473 0.11
474 0.11
475 0.11
476 0.1
477 0.11
478 0.09
479 0.13
480 0.14
481 0.21
482 0.22
483 0.22
484 0.24
485 0.24
486 0.27
487 0.24
488 0.23
489 0.21
490 0.23
491 0.23
492 0.2
493 0.21
494 0.19
495 0.2
496 0.2
497 0.19
498 0.19
499 0.21
500 0.21
501 0.24
502 0.23
503 0.25
504 0.27
505 0.29
506 0.32
507 0.34
508 0.34
509 0.37
510 0.38
511 0.4
512 0.44
513 0.47
514 0.48
515 0.5
516 0.52
517 0.53
518 0.57
519 0.6
520 0.56
521 0.57
522 0.56
523 0.56
524 0.58
525 0.54
526 0.5
527 0.43
528 0.39
529 0.29
530 0.24
531 0.18
532 0.17
533 0.15
534 0.15
535 0.14
536 0.13
537 0.14
538 0.15
539 0.16
540 0.16
541 0.21
542 0.23
543 0.29
544 0.32
545 0.33
546 0.37
547 0.42
548 0.4
549 0.4
550 0.43
551 0.44
552 0.46
553 0.46
554 0.44
555 0.47
556 0.51
557 0.48
558 0.43
559 0.38
560 0.37
561 0.39
562 0.4
563 0.42
564 0.4
565 0.43
566 0.46
567 0.49
568 0.46
569 0.49
570 0.55
571 0.55
572 0.55
573 0.52
574 0.5
575 0.52
576 0.52
577 0.48
578 0.41
579 0.33
580 0.29
581 0.29
582 0.28
583 0.21
584 0.22
585 0.22
586 0.19
587 0.18
588 0.15
589 0.14
590 0.14
591 0.14
592 0.15
593 0.2
594 0.27
595 0.29
596 0.37
597 0.46
598 0.5
599 0.59
600 0.66
601 0.69
602 0.73
603 0.8
604 0.83
605 0.84
606 0.9
607 0.9
608 0.92
609 0.92
610 0.92
611 0.91
612 0.9
613 0.91
614 0.9
615 0.9
616 0.89
617 0.83
618 0.82
619 0.82
620 0.83
621 0.77
622 0.73
623 0.7
624 0.61
625 0.6
626 0.5
627 0.4
628 0.32