Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1V4C8

Protein Details
Accession H1V4C8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22PQAAIKRTGKGKNQKVTKKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPQAAIKRTGKGKNQKVTKKFIINASQPASDKIFDVAAFEKFLQDKIKVEGRVGNLGDQVQISQQGEGKIEIIAHNELSGRYLKYLYVAIYAVFVPNVAIETDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.76
3 0.81
4 0.79
5 0.8
6 0.78
7 0.75
8 0.69
9 0.67
10 0.65
11 0.59
12 0.59
13 0.53
14 0.48
15 0.41
16 0.4
17 0.34
18 0.26
19 0.23
20 0.17
21 0.14
22 0.11
23 0.12
24 0.11
25 0.1
26 0.11
27 0.1
28 0.11
29 0.1
30 0.12
31 0.13
32 0.12
33 0.13
34 0.15
35 0.2
36 0.19
37 0.2
38 0.21
39 0.2
40 0.23
41 0.22
42 0.19
43 0.14
44 0.14
45 0.14
46 0.1
47 0.09
48 0.06
49 0.07
50 0.07
51 0.07
52 0.09
53 0.09
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.12
68 0.1
69 0.11
70 0.11
71 0.11
72 0.12
73 0.14
74 0.13
75 0.12
76 0.12
77 0.11
78 0.11
79 0.12
80 0.1
81 0.09
82 0.08
83 0.06
84 0.06
85 0.07