Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RBX0

Protein Details
Accession A0A5B1RBX0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-23RPPPPFRRAPPPFRRAPPPSBasic
125-157VSTPPPSSRSPRRRLNARRRRLRGPWRRLHALWHydrophilic
NLS Segment(s)
PositionSequence
4-49RPPPPFRRAPPPFRRAPPPSPRPLPPSTALHRRLDALRRRFDALRR
131-152SSRSPRRRLNARRRRLRGPWRR
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences GRLRPPPPFRRAPPPFRRAPPPSPRPLPPSTALHRRLDALRRRFDALRRRLHAPCRPPPPSAPSAAVCVLRRHFDALRRHFDALRRRLHAPCRPLSPSAAPCRPSPPSGRPPPTYGRPLAPSAAVSTPPPSSRSPRRRLNARRRRLRGPWRRLHALWAVLGAPSPSTRPASPSQRPAPLSCTLALPSRAPAPPHRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.77
4 0.81
5 0.77
6 0.78
7 0.78
8 0.76
9 0.78
10 0.75
11 0.74
12 0.71
13 0.67
14 0.62
15 0.56
16 0.54
17 0.52
18 0.56
19 0.55
20 0.52
21 0.49
22 0.48
23 0.48
24 0.5
25 0.52
26 0.51
27 0.52
28 0.52
29 0.55
30 0.55
31 0.57
32 0.58
33 0.58
34 0.59
35 0.56
36 0.59
37 0.6
38 0.66
39 0.66
40 0.64
41 0.64
42 0.64
43 0.63
44 0.6
45 0.58
46 0.56
47 0.51
48 0.45
49 0.39
50 0.31
51 0.31
52 0.3
53 0.29
54 0.24
55 0.24
56 0.23
57 0.22
58 0.21
59 0.22
60 0.22
61 0.26
62 0.34
63 0.37
64 0.43
65 0.44
66 0.45
67 0.43
68 0.47
69 0.49
70 0.47
71 0.46
72 0.43
73 0.43
74 0.47
75 0.54
76 0.54
77 0.5
78 0.46
79 0.44
80 0.43
81 0.41
82 0.38
83 0.33
84 0.33
85 0.33
86 0.34
87 0.31
88 0.29
89 0.32
90 0.32
91 0.3
92 0.3
93 0.31
94 0.36
95 0.44
96 0.49
97 0.47
98 0.49
99 0.52
100 0.52
101 0.49
102 0.42
103 0.36
104 0.33
105 0.32
106 0.29
107 0.23
108 0.19
109 0.17
110 0.16
111 0.14
112 0.11
113 0.12
114 0.13
115 0.13
116 0.16
117 0.17
118 0.24
119 0.34
120 0.43
121 0.5
122 0.58
123 0.65
124 0.73
125 0.81
126 0.85
127 0.85
128 0.86
129 0.88
130 0.85
131 0.85
132 0.85
133 0.85
134 0.84
135 0.84
136 0.83
137 0.8
138 0.81
139 0.73
140 0.68
141 0.61
142 0.52
143 0.42
144 0.33
145 0.26
146 0.19
147 0.19
148 0.13
149 0.09
150 0.08
151 0.09
152 0.11
153 0.14
154 0.14
155 0.19
156 0.27
157 0.36
158 0.43
159 0.51
160 0.54
161 0.58
162 0.61
163 0.59
164 0.55
165 0.5
166 0.45
167 0.37
168 0.33
169 0.27
170 0.29
171 0.29
172 0.26
173 0.24
174 0.27
175 0.29
176 0.31