Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W449

Protein Details
Accession H1W449    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-42ENSTLSRRRRAKKMRLQQGGSHydrophilic
NLS Segment(s)
PositionSequence
29-35RRRRAKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTRKRNDETGSSGSFNHKXLREENSTLSRRRRAKKMRLQQGGSLTVADAEDIQSQRDATAQVYEETRRRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.32
4 0.28
5 0.28
6 0.28
7 0.33
8 0.32
9 0.31
10 0.36
11 0.4
12 0.43
13 0.46
14 0.53
15 0.54
16 0.58
17 0.64
18 0.67
19 0.7
20 0.75
21 0.79
22 0.82
23 0.81
24 0.76
25 0.7
26 0.64
27 0.55
28 0.45
29 0.35
30 0.24
31 0.17
32 0.14
33 0.1
34 0.06
35 0.05
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.11
43 0.11
44 0.09
45 0.12
46 0.13
47 0.14
48 0.17
49 0.22
50 0.26