Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QXD9

Protein Details
Accession A0A5B1QXD9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-115EYQPSQRVRKRRHGFLARKRSVGGRKILVRRKAKQRRFLTHBasic
NLS Segment(s)
PositionSequence
81-111RVRKRRHGFLARKRSVGGRKILVRRKAKQRR
Subcellular Location(s) mito 20, nucl 4, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPLHLLRLVRPFPAQCPKFTPASPVTQFLPPSTFPPFLSRSLITRSLLHAAHNALPFAPPMLQVRHRSRGNEYQPSQRVRKRRHGFLARKRSVGGRKILVRRKAKQRRFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.44
4 0.41
5 0.37
6 0.42
7 0.43
8 0.42
9 0.41
10 0.41
11 0.33
12 0.39
13 0.38
14 0.35
15 0.34
16 0.33
17 0.33
18 0.28
19 0.28
20 0.2
21 0.21
22 0.23
23 0.22
24 0.19
25 0.23
26 0.25
27 0.24
28 0.27
29 0.24
30 0.22
31 0.25
32 0.27
33 0.24
34 0.22
35 0.22
36 0.22
37 0.21
38 0.19
39 0.16
40 0.15
41 0.17
42 0.16
43 0.15
44 0.11
45 0.11
46 0.1
47 0.09
48 0.08
49 0.06
50 0.08
51 0.11
52 0.16
53 0.23
54 0.29
55 0.36
56 0.38
57 0.39
58 0.43
59 0.5
60 0.52
61 0.55
62 0.52
63 0.53
64 0.58
65 0.61
66 0.62
67 0.58
68 0.61
69 0.59
70 0.68
71 0.66
72 0.69
73 0.74
74 0.77
75 0.82
76 0.84
77 0.87
78 0.8
79 0.74
80 0.67
81 0.64
82 0.61
83 0.57
84 0.53
85 0.49
86 0.53
87 0.61
88 0.68
89 0.7
90 0.71
91 0.74
92 0.79
93 0.83
94 0.84
95 0.84