Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QRA1

Protein Details
Accession A0A5B1QRA1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
376-404EDAERARRKAERRARKKAKKAAKRGAGVSBasic
NLS Segment(s)
PositionSequence
380-400RARRKAERRARKKAKKAAKRG
Subcellular Location(s) nucl 15, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MSEKSEKNFDFSDWSDNMPHAPPAYGRFSPPPGPPPQNPFHQSSGYHSDDLVYSGSRSRGLNDSYYSPPPGDPYGRGSSPYGGPSYAGSSQYQGPPQGYYPSASGYSQNDPSYRDGQQFPGFSYTGNTPHKRDPLNPPPACFMRRPNPQCPYPRLQESIHIPAQDKNTLEKGFMPIFPAPQLLMAHDVQPADLARLLEDCHLISAESVGQKITANVAPLAMGVGFLPGLLVTHGLENRMKRGNIEDAAGLVEVWDEAFFAPRRLRLTMQRGRAYEYNDSSSSDSDSDDNYRHRTSRGAYDMMPPPPVVGYGYRGLVGRRSALGPRPTLVGALRAEAGIRGPGLLGGVGLVRGARMALQQEIVADQYAHHDQRLAAEDAERARRKAERRARKKAKKAAKRGAGVSGMGDQRIYLVISNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.28
4 0.3
5 0.25
6 0.25
7 0.19
8 0.19
9 0.19
10 0.22
11 0.28
12 0.27
13 0.29
14 0.32
15 0.36
16 0.41
17 0.43
18 0.45
19 0.47
20 0.53
21 0.54
22 0.57
23 0.57
24 0.61
25 0.6
26 0.59
27 0.54
28 0.51
29 0.47
30 0.46
31 0.49
32 0.43
33 0.39
34 0.34
35 0.31
36 0.27
37 0.27
38 0.21
39 0.14
40 0.11
41 0.13
42 0.15
43 0.16
44 0.16
45 0.18
46 0.22
47 0.25
48 0.27
49 0.27
50 0.31
51 0.33
52 0.35
53 0.34
54 0.29
55 0.27
56 0.26
57 0.28
58 0.26
59 0.23
60 0.27
61 0.31
62 0.3
63 0.32
64 0.31
65 0.29
66 0.29
67 0.29
68 0.24
69 0.18
70 0.18
71 0.17
72 0.19
73 0.19
74 0.18
75 0.16
76 0.17
77 0.2
78 0.23
79 0.24
80 0.22
81 0.21
82 0.21
83 0.21
84 0.23
85 0.2
86 0.19
87 0.17
88 0.17
89 0.18
90 0.17
91 0.19
92 0.19
93 0.22
94 0.24
95 0.25
96 0.24
97 0.25
98 0.29
99 0.3
100 0.29
101 0.29
102 0.27
103 0.3
104 0.33
105 0.31
106 0.29
107 0.28
108 0.25
109 0.21
110 0.22
111 0.19
112 0.23
113 0.29
114 0.31
115 0.31
116 0.37
117 0.43
118 0.43
119 0.46
120 0.49
121 0.51
122 0.59
123 0.57
124 0.53
125 0.52
126 0.53
127 0.51
128 0.43
129 0.4
130 0.38
131 0.47
132 0.52
133 0.55
134 0.57
135 0.61
136 0.66
137 0.65
138 0.62
139 0.57
140 0.55
141 0.51
142 0.46
143 0.44
144 0.42
145 0.42
146 0.37
147 0.33
148 0.3
149 0.3
150 0.32
151 0.29
152 0.25
153 0.21
154 0.23
155 0.22
156 0.22
157 0.19
158 0.2
159 0.19
160 0.18
161 0.19
162 0.15
163 0.15
164 0.15
165 0.14
166 0.11
167 0.11
168 0.11
169 0.08
170 0.11
171 0.1
172 0.11
173 0.12
174 0.11
175 0.09
176 0.1
177 0.09
178 0.07
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.07
185 0.08
186 0.07
187 0.06
188 0.06
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.08
200 0.07
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.02
215 0.02
216 0.02
217 0.03
218 0.03
219 0.05
220 0.05
221 0.07
222 0.1
223 0.1
224 0.14
225 0.18
226 0.18
227 0.17
228 0.2
229 0.23
230 0.21
231 0.22
232 0.18
233 0.14
234 0.15
235 0.14
236 0.1
237 0.06
238 0.05
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.06
245 0.07
246 0.09
247 0.11
248 0.13
249 0.16
250 0.18
251 0.22
252 0.27
253 0.36
254 0.41
255 0.48
256 0.51
257 0.49
258 0.52
259 0.51
260 0.47
261 0.43
262 0.38
263 0.34
264 0.29
265 0.3
266 0.27
267 0.24
268 0.22
269 0.17
270 0.15
271 0.12
272 0.13
273 0.14
274 0.15
275 0.18
276 0.21
277 0.23
278 0.23
279 0.23
280 0.25
281 0.26
282 0.31
283 0.33
284 0.31
285 0.3
286 0.35
287 0.4
288 0.37
289 0.36
290 0.27
291 0.22
292 0.2
293 0.19
294 0.14
295 0.1
296 0.12
297 0.12
298 0.13
299 0.14
300 0.15
301 0.15
302 0.17
303 0.17
304 0.15
305 0.15
306 0.16
307 0.19
308 0.26
309 0.3
310 0.28
311 0.28
312 0.28
313 0.27
314 0.26
315 0.23
316 0.21
317 0.17
318 0.16
319 0.15
320 0.13
321 0.13
322 0.12
323 0.12
324 0.08
325 0.07
326 0.06
327 0.06
328 0.06
329 0.06
330 0.05
331 0.05
332 0.04
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.04
339 0.04
340 0.05
341 0.06
342 0.09
343 0.1
344 0.11
345 0.11
346 0.11
347 0.12
348 0.12
349 0.11
350 0.09
351 0.08
352 0.12
353 0.18
354 0.18
355 0.18
356 0.19
357 0.19
358 0.24
359 0.29
360 0.26
361 0.21
362 0.21
363 0.25
364 0.28
365 0.37
366 0.36
367 0.31
368 0.33
369 0.4
370 0.44
371 0.52
372 0.58
373 0.59
374 0.67
375 0.78
376 0.85
377 0.89
378 0.94
379 0.94
380 0.94
381 0.93
382 0.94
383 0.93
384 0.91
385 0.87
386 0.79
387 0.75
388 0.66
389 0.56
390 0.46
391 0.42
392 0.34
393 0.27
394 0.24
395 0.17
396 0.15
397 0.16
398 0.15