Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QG64

Protein Details
Accession A0A5B1QG64    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-31SPNITPTKQSKAQKSRARREPSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR018247  EF_Hand_1_Ca_BS  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
Pfam View protein in Pfam  
PF00036  EF-hand_1  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
PS50222  EF_HAND_2  
Amino Acid Sequences MSRYPEYLSPNITPTKQSKAQKSRARREPSGVFSLFQAPQVQQFKEAFSLIDQDHDGVVSEQDLKEIFGSLGITPTKRMLDELLTARPGGHDRMGSASSADDSSDRGINFAMFLTMMSEHLFEFDTEAELVEAFACFDEGDTGTVKGDEIRKWLSETGDRMDQAEIDRFLKGSFSDHHGNFKYKEWVKVLRVNEDGDSEVPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.43
4 0.49
5 0.55
6 0.61
7 0.7
8 0.74
9 0.81
10 0.84
11 0.86
12 0.87
13 0.8
14 0.77
15 0.74
16 0.71
17 0.67
18 0.57
19 0.47
20 0.4
21 0.41
22 0.34
23 0.28
24 0.24
25 0.17
26 0.24
27 0.28
28 0.27
29 0.26
30 0.26
31 0.26
32 0.25
33 0.25
34 0.18
35 0.14
36 0.17
37 0.13
38 0.14
39 0.13
40 0.12
41 0.11
42 0.11
43 0.11
44 0.07
45 0.07
46 0.06
47 0.08
48 0.07
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.07
55 0.06
56 0.07
57 0.06
58 0.09
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12
64 0.11
65 0.11
66 0.1
67 0.1
68 0.14
69 0.15
70 0.15
71 0.15
72 0.15
73 0.14
74 0.14
75 0.14
76 0.11
77 0.1
78 0.09
79 0.09
80 0.11
81 0.12
82 0.11
83 0.1
84 0.08
85 0.08
86 0.08
87 0.07
88 0.05
89 0.05
90 0.06
91 0.08
92 0.08
93 0.07
94 0.08
95 0.07
96 0.07
97 0.07
98 0.06
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.05
127 0.06
128 0.07
129 0.07
130 0.07
131 0.08
132 0.08
133 0.1
134 0.13
135 0.13
136 0.16
137 0.18
138 0.19
139 0.21
140 0.23
141 0.23
142 0.24
143 0.26
144 0.26
145 0.28
146 0.27
147 0.26
148 0.25
149 0.23
150 0.21
151 0.22
152 0.19
153 0.16
154 0.16
155 0.15
156 0.15
157 0.15
158 0.14
159 0.13
160 0.13
161 0.19
162 0.26
163 0.27
164 0.35
165 0.38
166 0.42
167 0.41
168 0.43
169 0.47
170 0.43
171 0.48
172 0.46
173 0.5
174 0.51
175 0.57
176 0.56
177 0.53
178 0.52
179 0.48
180 0.44
181 0.38
182 0.34