Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RGT3

Protein Details
Accession A0A5B1RGT3    Localization Confidence High Confidence Score 21.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-89SSSTTPRRAPSRSQRSPRWRERAAGHydrophilic
297-317PRAQGRPCRRRVPQRRLCASSHydrophilic
359-387AQGRLHTPSRRRPARPRRHLVHPRCRLWSBasic
NLS Segment(s)
PositionSequence
71-118RRAPSRSQRSPRWRERAAGARGARVQMARIWRGGQWKGQRRAVERARR
151-176TRSRRVVPTRSASRPRAPHPAHAPRP
367-376SRRRPARPRR
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSPWALVPWQHVLTSTSRTPSGSSHAPAASFQGRDPTMPPRRLSDAAPRPSDVVEALWRPSSNASSSTTPRRAPSRSQRSPRWRERAAGARGARVQMARIWRGGQWKGQRRAVERARRAVEGAEGLTFALVPACAASPLHLAPSRARSSPTRSRRVVPTRSASRPRAPHPAHAPRPPPALAVSRLLAPSSARSPRLAPAPCLPLRARHAFSRAAAVLAHLHAAPQQPRHAPASPSRARACAPRPLAPPPASRPRTPPLRSRDTPLCRCLAPACVRATPSLAPQPPSRARTAPSSLMPRAQGRPCRRRVPQRRLCASSRTVTPPCAQAQQSRAQCRCHAPQRCAVPPPPTLPQPPGATLAQGRLHTPSRRRPARPRRHLVHPRCRLWSVARALATPPCGTPTPLTVLWHCRHAPHAWHLNALARCWHMPSLRRHALRRSDAVAYLTAIMHSCALAHPSHAPASHTPAAISHAHAAPLGCSWCHIGHTWHVFARSVPVHHGLNPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.27
4 0.27
5 0.28
6 0.28
7 0.28
8 0.32
9 0.31
10 0.3
11 0.31
12 0.31
13 0.31
14 0.3
15 0.33
16 0.31
17 0.26
18 0.24
19 0.27
20 0.26
21 0.27
22 0.29
23 0.34
24 0.39
25 0.44
26 0.45
27 0.43
28 0.49
29 0.5
30 0.51
31 0.51
32 0.52
33 0.54
34 0.55
35 0.51
36 0.46
37 0.45
38 0.42
39 0.31
40 0.24
41 0.21
42 0.2
43 0.21
44 0.22
45 0.22
46 0.22
47 0.24
48 0.24
49 0.21
50 0.21
51 0.23
52 0.26
53 0.32
54 0.4
55 0.43
56 0.43
57 0.46
58 0.5
59 0.51
60 0.56
61 0.61
62 0.63
63 0.68
64 0.74
65 0.8
66 0.84
67 0.9
68 0.9
69 0.88
70 0.81
71 0.75
72 0.73
73 0.73
74 0.67
75 0.65
76 0.55
77 0.51
78 0.5
79 0.46
80 0.41
81 0.31
82 0.27
83 0.22
84 0.27
85 0.24
86 0.23
87 0.24
88 0.24
89 0.31
90 0.32
91 0.36
92 0.4
93 0.48
94 0.54
95 0.58
96 0.61
97 0.59
98 0.67
99 0.69
100 0.69
101 0.66
102 0.67
103 0.64
104 0.59
105 0.55
106 0.46
107 0.38
108 0.29
109 0.23
110 0.14
111 0.11
112 0.1
113 0.09
114 0.08
115 0.06
116 0.04
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.06
124 0.07
125 0.08
126 0.12
127 0.13
128 0.14
129 0.17
130 0.24
131 0.26
132 0.25
133 0.28
134 0.29
135 0.35
136 0.44
137 0.51
138 0.53
139 0.53
140 0.57
141 0.64
142 0.69
143 0.68
144 0.64
145 0.64
146 0.63
147 0.68
148 0.71
149 0.67
150 0.65
151 0.64
152 0.61
153 0.63
154 0.57
155 0.56
156 0.58
157 0.63
158 0.62
159 0.63
160 0.62
161 0.55
162 0.56
163 0.49
164 0.41
165 0.33
166 0.3
167 0.25
168 0.24
169 0.21
170 0.19
171 0.18
172 0.17
173 0.15
174 0.11
175 0.12
176 0.15
177 0.17
178 0.17
179 0.18
180 0.19
181 0.22
182 0.29
183 0.28
184 0.25
185 0.26
186 0.32
187 0.32
188 0.34
189 0.32
190 0.3
191 0.33
192 0.37
193 0.35
194 0.3
195 0.33
196 0.31
197 0.31
198 0.3
199 0.25
200 0.19
201 0.17
202 0.15
203 0.12
204 0.1
205 0.11
206 0.06
207 0.06
208 0.07
209 0.1
210 0.12
211 0.13
212 0.16
213 0.17
214 0.19
215 0.23
216 0.24
217 0.23
218 0.27
219 0.35
220 0.35
221 0.39
222 0.38
223 0.36
224 0.34
225 0.37
226 0.35
227 0.33
228 0.32
229 0.33
230 0.34
231 0.36
232 0.41
233 0.38
234 0.38
235 0.36
236 0.43
237 0.4
238 0.39
239 0.4
240 0.41
241 0.48
242 0.48
243 0.5
244 0.47
245 0.53
246 0.53
247 0.54
248 0.58
249 0.57
250 0.58
251 0.52
252 0.47
253 0.38
254 0.38
255 0.33
256 0.29
257 0.25
258 0.25
259 0.25
260 0.24
261 0.25
262 0.24
263 0.25
264 0.19
265 0.18
266 0.2
267 0.19
268 0.21
269 0.21
270 0.28
271 0.32
272 0.34
273 0.34
274 0.29
275 0.29
276 0.33
277 0.35
278 0.31
279 0.29
280 0.32
281 0.3
282 0.31
283 0.31
284 0.29
285 0.3
286 0.33
287 0.38
288 0.42
289 0.5
290 0.55
291 0.61
292 0.66
293 0.71
294 0.77
295 0.8
296 0.79
297 0.81
298 0.81
299 0.79
300 0.74
301 0.68
302 0.61
303 0.53
304 0.48
305 0.44
306 0.38
307 0.35
308 0.34
309 0.32
310 0.3
311 0.31
312 0.28
313 0.26
314 0.28
315 0.34
316 0.39
317 0.44
318 0.45
319 0.43
320 0.45
321 0.47
322 0.52
323 0.53
324 0.54
325 0.5
326 0.53
327 0.57
328 0.58
329 0.57
330 0.52
331 0.47
332 0.43
333 0.43
334 0.4
335 0.37
336 0.35
337 0.33
338 0.34
339 0.31
340 0.3
341 0.29
342 0.25
343 0.24
344 0.22
345 0.24
346 0.22
347 0.2
348 0.2
349 0.2
350 0.25
351 0.3
352 0.36
353 0.41
354 0.49
355 0.57
356 0.64
357 0.72
358 0.78
359 0.83
360 0.87
361 0.87
362 0.83
363 0.85
364 0.88
365 0.88
366 0.87
367 0.86
368 0.8
369 0.75
370 0.7
371 0.63
372 0.56
373 0.54
374 0.48
375 0.43
376 0.38
377 0.34
378 0.35
379 0.34
380 0.32
381 0.24
382 0.19
383 0.17
384 0.17
385 0.18
386 0.18
387 0.18
388 0.21
389 0.22
390 0.24
391 0.24
392 0.31
393 0.31
394 0.36
395 0.34
396 0.3
397 0.32
398 0.34
399 0.36
400 0.37
401 0.45
402 0.4
403 0.41
404 0.41
405 0.45
406 0.42
407 0.37
408 0.32
409 0.25
410 0.24
411 0.25
412 0.28
413 0.25
414 0.31
415 0.39
416 0.46
417 0.52
418 0.58
419 0.6
420 0.65
421 0.7
422 0.69
423 0.66
424 0.59
425 0.53
426 0.49
427 0.46
428 0.38
429 0.29
430 0.24
431 0.19
432 0.15
433 0.13
434 0.11
435 0.09
436 0.08
437 0.08
438 0.07
439 0.09
440 0.09
441 0.11
442 0.13
443 0.15
444 0.18
445 0.19
446 0.22
447 0.22
448 0.3
449 0.32
450 0.3
451 0.27
452 0.26
453 0.28
454 0.26
455 0.26
456 0.22
457 0.19
458 0.2
459 0.21
460 0.2
461 0.17
462 0.19
463 0.18
464 0.14
465 0.14
466 0.16
467 0.16
468 0.18
469 0.2
470 0.2
471 0.27
472 0.33
473 0.36
474 0.36
475 0.37
476 0.35
477 0.34
478 0.38
479 0.34
480 0.3
481 0.3
482 0.32
483 0.32