Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R7J9

Protein Details
Accession A0A5B1R7J9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-83WARACSRRRVVTRIKRQRWRAHVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MRRCVLACAGVVRACEHVYILMMCVEWQGESDLSCRVAVMAQESCDSTSTENAARVQEGAWARACSRRRVVTRIKRQRWRAHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.1
5 0.1
6 0.1
7 0.09
8 0.08
9 0.07
10 0.07
11 0.07
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.08
21 0.08
22 0.08
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.09
37 0.1
38 0.11
39 0.12
40 0.12
41 0.12
42 0.12
43 0.11
44 0.14
45 0.14
46 0.14
47 0.15
48 0.16
49 0.17
50 0.24
51 0.26
52 0.27
53 0.34
54 0.4
55 0.43
56 0.5
57 0.6
58 0.64
59 0.73
60 0.79
61 0.82
62 0.84
63 0.89