Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BP50

Protein Details
Accession A0A5M6BP50    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
363-399EKKGGKTAVKKAIEKKRKKTASKEKKSRPFAKGESGMBasic
NLS Segment(s)
PositionSequence
328-408AKKEEREKREHGKGAWYMKKGEKRDLLLKARFETLEKKGGKTAVKKAIEKKRKKTASKEKKSRPFAKGESGMGGDAKRRRV
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MVKASSVLKGKARAQAQTQTSSKRTRGPSPDDSLLDSDSEVDEFAQDYASGSGSGSGSGASDDDDNELEDGGSEEEEVEGNARWEPDDWDEEEDSDQDESESEDGDEQDDNAAELRRLQNDLTSLPLSTLAKAQKALGSRKSTSSASSSSNKEDKLQAIKAKLAQLQKGKGKAVDVPLYEDDRAGRRHGDSDSSDDDGPESQSSLKRGNKHAPASMSTKRQVSRNRQVVDVHKPERRDPRFSSVSAGQVDPHLHSQSYAFLPSLLKEELYKLRKAVSAAAKVERTCPWAEKPARTAEREKLEDQLGKLRTRLVRTEREEMERNVLASAKKEEREKREHGKGAWYMKKGEKRDLLLKARFETLEKKGGKTAVKKAIEKKRKKTASKEKKSRPFAKGESGMGGDAKRRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.52
4 0.54
5 0.54
6 0.54
7 0.57
8 0.59
9 0.57
10 0.57
11 0.58
12 0.59
13 0.63
14 0.64
15 0.66
16 0.67
17 0.69
18 0.62
19 0.59
20 0.52
21 0.43
22 0.35
23 0.27
24 0.2
25 0.14
26 0.13
27 0.1
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.07
35 0.08
36 0.08
37 0.08
38 0.07
39 0.09
40 0.08
41 0.09
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.08
56 0.07
57 0.08
58 0.07
59 0.06
60 0.06
61 0.05
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.12
73 0.14
74 0.17
75 0.18
76 0.2
77 0.21
78 0.21
79 0.21
80 0.18
81 0.16
82 0.13
83 0.12
84 0.08
85 0.07
86 0.08
87 0.07
88 0.07
89 0.06
90 0.07
91 0.07
92 0.08
93 0.08
94 0.07
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.07
101 0.11
102 0.13
103 0.14
104 0.16
105 0.16
106 0.16
107 0.18
108 0.18
109 0.18
110 0.16
111 0.14
112 0.13
113 0.16
114 0.14
115 0.13
116 0.17
117 0.15
118 0.16
119 0.17
120 0.17
121 0.17
122 0.22
123 0.27
124 0.29
125 0.33
126 0.33
127 0.35
128 0.38
129 0.35
130 0.32
131 0.3
132 0.26
133 0.25
134 0.28
135 0.28
136 0.3
137 0.33
138 0.32
139 0.3
140 0.3
141 0.29
142 0.3
143 0.32
144 0.31
145 0.29
146 0.3
147 0.31
148 0.32
149 0.33
150 0.3
151 0.31
152 0.31
153 0.36
154 0.38
155 0.39
156 0.36
157 0.32
158 0.3
159 0.28
160 0.28
161 0.26
162 0.21
163 0.22
164 0.22
165 0.23
166 0.22
167 0.19
168 0.16
169 0.15
170 0.16
171 0.14
172 0.14
173 0.13
174 0.15
175 0.16
176 0.18
177 0.16
178 0.19
179 0.2
180 0.2
181 0.2
182 0.17
183 0.17
184 0.14
185 0.13
186 0.09
187 0.08
188 0.07
189 0.09
190 0.11
191 0.17
192 0.2
193 0.24
194 0.29
195 0.36
196 0.41
197 0.42
198 0.43
199 0.38
200 0.38
201 0.39
202 0.39
203 0.36
204 0.32
205 0.34
206 0.33
207 0.37
208 0.43
209 0.46
210 0.52
211 0.56
212 0.55
213 0.53
214 0.55
215 0.54
216 0.54
217 0.52
218 0.47
219 0.41
220 0.42
221 0.46
222 0.53
223 0.52
224 0.5
225 0.46
226 0.49
227 0.5
228 0.49
229 0.47
230 0.39
231 0.38
232 0.33
233 0.29
234 0.21
235 0.19
236 0.19
237 0.16
238 0.16
239 0.13
240 0.11
241 0.11
242 0.12
243 0.13
244 0.13
245 0.13
246 0.1
247 0.1
248 0.11
249 0.11
250 0.14
251 0.11
252 0.1
253 0.1
254 0.14
255 0.21
256 0.24
257 0.25
258 0.22
259 0.25
260 0.26
261 0.27
262 0.3
263 0.29
264 0.31
265 0.33
266 0.36
267 0.36
268 0.35
269 0.37
270 0.31
271 0.28
272 0.24
273 0.24
274 0.24
275 0.31
276 0.35
277 0.37
278 0.39
279 0.45
280 0.48
281 0.49
282 0.51
283 0.49
284 0.52
285 0.52
286 0.49
287 0.42
288 0.42
289 0.4
290 0.37
291 0.37
292 0.34
293 0.31
294 0.3
295 0.33
296 0.33
297 0.34
298 0.4
299 0.4
300 0.45
301 0.5
302 0.57
303 0.54
304 0.56
305 0.57
306 0.51
307 0.5
308 0.41
309 0.36
310 0.29
311 0.28
312 0.23
313 0.21
314 0.26
315 0.25
316 0.28
317 0.36
318 0.43
319 0.49
320 0.56
321 0.61
322 0.64
323 0.69
324 0.71
325 0.65
326 0.65
327 0.64
328 0.66
329 0.65
330 0.58
331 0.54
332 0.56
333 0.62
334 0.58
335 0.6
336 0.56
337 0.55
338 0.6
339 0.64
340 0.65
341 0.63
342 0.63
343 0.57
344 0.54
345 0.49
346 0.44
347 0.41
348 0.37
349 0.4
350 0.38
351 0.37
352 0.38
353 0.43
354 0.47
355 0.48
356 0.52
357 0.53
358 0.58
359 0.63
360 0.69
361 0.75
362 0.78
363 0.81
364 0.81
365 0.82
366 0.86
367 0.87
368 0.89
369 0.89
370 0.9
371 0.91
372 0.93
373 0.92
374 0.93
375 0.95
376 0.93
377 0.88
378 0.87
379 0.81
380 0.8
381 0.75
382 0.66
383 0.6
384 0.51
385 0.45
386 0.38
387 0.33
388 0.3