Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BUV3

Protein Details
Accession A0A5M6BUV3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-90GGFFGRKMYLRRKKRRAEQNAVTEKVHydrophilic
NLS Segment(s)
PositionSequence
75-80RRKKRR
Subcellular Location(s) mito 14, mito_nucl 7, plas 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSPTVVKMTTSMSSPIGAFTTLSDPSASSTASSWVNPVDSKGQTVPNWEWGVIVIVIVLALGLGGFFGRKMYLRRKKRRAEQNAVTEKVAEVAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.13
5 0.12
6 0.1
7 0.1
8 0.12
9 0.11
10 0.11
11 0.11
12 0.1
13 0.11
14 0.12
15 0.11
16 0.08
17 0.08
18 0.1
19 0.11
20 0.11
21 0.1
22 0.09
23 0.11
24 0.1
25 0.11
26 0.13
27 0.12
28 0.14
29 0.15
30 0.17
31 0.17
32 0.21
33 0.2
34 0.21
35 0.21
36 0.2
37 0.18
38 0.15
39 0.15
40 0.11
41 0.1
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.01
48 0.01
49 0.01
50 0.01
51 0.01
52 0.02
53 0.02
54 0.02
55 0.03
56 0.04
57 0.06
58 0.12
59 0.23
60 0.34
61 0.45
62 0.57
63 0.67
64 0.76
65 0.84
66 0.9
67 0.9
68 0.9
69 0.88
70 0.88
71 0.87
72 0.8
73 0.7
74 0.59
75 0.49