Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6CC95

Protein Details
Accession A0A5M6CC95   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPAERKPLNKYRKPRPGPSTSTKTSHydrophilic
NLS Segment(s)
PositionSequence
94-134EKKNGAKYHKVKFFERQKLLRLTKRLNRKISEEGKSEKKKA
Subcellular Location(s) cyto_nucl 12.5, nucl 23.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPAERKPLNKYRKPRPGPSTSTKTSERPSEHKVLPVDQRSEGALPGLSKIKSAIRQTKRLLAKETLEPGLRIATQRRLTSLEADLAAAERREVEKKNGAKYHKVKFFERQKLLRLTKRLNRKISEEGKSEKKKARYEQDLTDARVMLNYVLHYPNTQKYISLFPSNATTASTSKPEDEIDEEDSKSKLSLPPLLHPAPSNPSKLDQSAQRRYELLQETLKLMDEGKLSKEPEVEVTSGKTLGSGVEIGLGRSNVVSQNKDGKKTVEEEEEKDDFFEADD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.84
5 0.84
6 0.81
7 0.75
8 0.73
9 0.67
10 0.64
11 0.59
12 0.59
13 0.56
14 0.53
15 0.56
16 0.58
17 0.55
18 0.56
19 0.53
20 0.51
21 0.53
22 0.53
23 0.49
24 0.42
25 0.41
26 0.37
27 0.34
28 0.28
29 0.21
30 0.15
31 0.12
32 0.14
33 0.17
34 0.15
35 0.15
36 0.17
37 0.2
38 0.25
39 0.34
40 0.42
41 0.44
42 0.53
43 0.56
44 0.63
45 0.65
46 0.63
47 0.6
48 0.53
49 0.5
50 0.47
51 0.47
52 0.42
53 0.35
54 0.31
55 0.26
56 0.24
57 0.21
58 0.18
59 0.18
60 0.23
61 0.27
62 0.27
63 0.29
64 0.3
65 0.31
66 0.31
67 0.29
68 0.23
69 0.18
70 0.18
71 0.15
72 0.13
73 0.13
74 0.09
75 0.08
76 0.07
77 0.09
78 0.12
79 0.14
80 0.18
81 0.26
82 0.3
83 0.38
84 0.43
85 0.45
86 0.51
87 0.56
88 0.61
89 0.6
90 0.59
91 0.55
92 0.58
93 0.65
94 0.65
95 0.65
96 0.59
97 0.58
98 0.63
99 0.67
100 0.63
101 0.59
102 0.57
103 0.56
104 0.63
105 0.66
106 0.63
107 0.59
108 0.58
109 0.6
110 0.6
111 0.58
112 0.51
113 0.48
114 0.51
115 0.53
116 0.54
117 0.5
118 0.5
119 0.51
120 0.54
121 0.58
122 0.56
123 0.56
124 0.53
125 0.56
126 0.52
127 0.47
128 0.41
129 0.33
130 0.24
131 0.21
132 0.18
133 0.09
134 0.07
135 0.06
136 0.07
137 0.07
138 0.08
139 0.08
140 0.11
141 0.13
142 0.15
143 0.15
144 0.13
145 0.14
146 0.19
147 0.21
148 0.21
149 0.19
150 0.17
151 0.19
152 0.19
153 0.18
154 0.14
155 0.13
156 0.12
157 0.13
158 0.15
159 0.13
160 0.13
161 0.14
162 0.14
163 0.13
164 0.15
165 0.15
166 0.18
167 0.19
168 0.18
169 0.18
170 0.18
171 0.17
172 0.15
173 0.14
174 0.12
175 0.13
176 0.19
177 0.19
178 0.23
179 0.3
180 0.31
181 0.3
182 0.28
183 0.28
184 0.28
185 0.29
186 0.27
187 0.22
188 0.24
189 0.26
190 0.27
191 0.28
192 0.3
193 0.37
194 0.44
195 0.45
196 0.43
197 0.42
198 0.41
199 0.45
200 0.41
201 0.36
202 0.29
203 0.28
204 0.28
205 0.28
206 0.27
207 0.19
208 0.16
209 0.14
210 0.13
211 0.14
212 0.16
213 0.2
214 0.2
215 0.22
216 0.22
217 0.21
218 0.23
219 0.24
220 0.22
221 0.18
222 0.2
223 0.19
224 0.19
225 0.17
226 0.13
227 0.11
228 0.1
229 0.1
230 0.08
231 0.06
232 0.1
233 0.11
234 0.11
235 0.13
236 0.13
237 0.12
238 0.11
239 0.13
240 0.15
241 0.19
242 0.21
243 0.23
244 0.34
245 0.39
246 0.43
247 0.44
248 0.42
249 0.41
250 0.43
251 0.44
252 0.44
253 0.43
254 0.42
255 0.47
256 0.46
257 0.42
258 0.38
259 0.34