Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C2Z0

Protein Details
Accession A0A5M6C2Z0   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
164-183VSNRLGKRRRRRGGDNDSRABasic
NLS Segment(s)
PositionSequence
169-175GKRRRRR
288-297KKIGKKRVGK
Subcellular Location(s) cyto 6.5, cyto_mito 5, mito 2.5, nucl 16
Family & Domain DBs
InterPro View protein in InterPro  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MPLPASHTKHLDLLAHPIPRQPDHLLLPLRQISSSSSEGATKNGNGSTGTTGTTLWLSGQVLACYLSSLPLPTTTASSSSKSNPNFGQNGNTPRPRVLELGSGIGYTSLCLASFGYEVLASDIEPVLSGVLSDNVENGLRVMRASMERGRVGEVVVKNLDWEDVSNRLGKRRRRRGGDNDSRAMDDDAMEKVEVGSNGENGNDDLDWLDDNPWDMIVMTDTFYAPHLIAPLWDTLEYVSTSQPASNTTTTSSPPSTRIPPIYIGIEVRDPPLIAQALEEGRQRGFELKKIGKKRVGKELERWGWKSEDWEGVEIWKAKWRGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.33
4 0.34
5 0.36
6 0.35
7 0.38
8 0.34
9 0.33
10 0.33
11 0.4
12 0.41
13 0.38
14 0.43
15 0.42
16 0.39
17 0.34
18 0.31
19 0.26
20 0.27
21 0.28
22 0.22
23 0.19
24 0.22
25 0.22
26 0.24
27 0.24
28 0.19
29 0.2
30 0.19
31 0.19
32 0.16
33 0.17
34 0.19
35 0.17
36 0.17
37 0.14
38 0.14
39 0.14
40 0.13
41 0.12
42 0.08
43 0.09
44 0.09
45 0.11
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.12
61 0.12
62 0.15
63 0.17
64 0.18
65 0.2
66 0.23
67 0.3
68 0.29
69 0.33
70 0.32
71 0.36
72 0.37
73 0.36
74 0.37
75 0.36
76 0.42
77 0.45
78 0.46
79 0.41
80 0.39
81 0.41
82 0.37
83 0.32
84 0.26
85 0.24
86 0.21
87 0.22
88 0.2
89 0.18
90 0.15
91 0.14
92 0.12
93 0.07
94 0.07
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.04
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.07
131 0.1
132 0.12
133 0.14
134 0.15
135 0.15
136 0.17
137 0.15
138 0.15
139 0.17
140 0.14
141 0.14
142 0.13
143 0.13
144 0.11
145 0.11
146 0.11
147 0.06
148 0.06
149 0.06
150 0.07
151 0.08
152 0.12
153 0.13
154 0.19
155 0.26
156 0.34
157 0.43
158 0.52
159 0.6
160 0.63
161 0.71
162 0.75
163 0.8
164 0.82
165 0.78
166 0.71
167 0.64
168 0.57
169 0.49
170 0.39
171 0.28
172 0.17
173 0.12
174 0.09
175 0.08
176 0.08
177 0.07
178 0.06
179 0.07
180 0.07
181 0.07
182 0.07
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.08
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.06
195 0.06
196 0.06
197 0.07
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.08
211 0.07
212 0.07
213 0.07
214 0.07
215 0.07
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.07
222 0.09
223 0.09
224 0.09
225 0.09
226 0.09
227 0.09
228 0.1
229 0.1
230 0.11
231 0.14
232 0.14
233 0.15
234 0.16
235 0.18
236 0.19
237 0.23
238 0.24
239 0.21
240 0.24
241 0.27
242 0.3
243 0.33
244 0.35
245 0.33
246 0.32
247 0.34
248 0.32
249 0.29
250 0.25
251 0.22
252 0.21
253 0.19
254 0.18
255 0.16
256 0.14
257 0.12
258 0.16
259 0.14
260 0.12
261 0.11
262 0.14
263 0.14
264 0.17
265 0.19
266 0.17
267 0.16
268 0.17
269 0.18
270 0.22
271 0.22
272 0.25
273 0.33
274 0.4
275 0.49
276 0.56
277 0.64
278 0.65
279 0.72
280 0.73
281 0.74
282 0.75
283 0.72
284 0.72
285 0.75
286 0.76
287 0.75
288 0.71
289 0.64
290 0.57
291 0.52
292 0.48
293 0.41
294 0.39
295 0.33
296 0.33
297 0.3
298 0.28
299 0.33
300 0.31
301 0.28
302 0.28
303 0.27