Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BT23

Protein Details
Accession A0A5M6BT23   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-88SGQLRNLRFRSRRRKSTTKTDNNQSNSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, cyto_mito 10.333, mito 10.5, mito_nucl 9.666, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSAPNPSSSSTNPTPTLFPTLYSLLPPSLHPTLLSHLSLLSIHAEQYYIIDRIYTTTNPVVSGQLRNLRFRSRRRKSTTKTDNNQSNSDGAVGKEGKETAGEWLYTLEYVSAPLRSAEYSEASVRAIIGIEIKGMSGKDEVEEFITAMGFQHSHTYTLSGLLFHIPIPAPSNPPLTLQITITNLIPLSSATPTSHPTTISPTNPSLVGGTEPYLVQIHPSRPVNPVPIPGDVGLQDMIGLMRDLAGRVDVDGLEWSTGSMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.4
4 0.32
5 0.28
6 0.27
7 0.27
8 0.25
9 0.25
10 0.24
11 0.18
12 0.19
13 0.18
14 0.21
15 0.2
16 0.2
17 0.19
18 0.19
19 0.22
20 0.25
21 0.24
22 0.18
23 0.16
24 0.17
25 0.16
26 0.15
27 0.13
28 0.09
29 0.09
30 0.09
31 0.09
32 0.08
33 0.1
34 0.12
35 0.1
36 0.1
37 0.1
38 0.09
39 0.11
40 0.15
41 0.13
42 0.14
43 0.16
44 0.16
45 0.17
46 0.18
47 0.19
48 0.18
49 0.2
50 0.21
51 0.26
52 0.28
53 0.32
54 0.34
55 0.4
56 0.46
57 0.54
58 0.6
59 0.63
60 0.71
61 0.76
62 0.84
63 0.82
64 0.85
65 0.86
66 0.86
67 0.83
68 0.82
69 0.82
70 0.75
71 0.7
72 0.6
73 0.49
74 0.39
75 0.32
76 0.23
77 0.15
78 0.15
79 0.13
80 0.12
81 0.12
82 0.12
83 0.11
84 0.1
85 0.11
86 0.09
87 0.1
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.06
95 0.04
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.08
106 0.09
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.07
113 0.06
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.06
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.08
139 0.08
140 0.09
141 0.09
142 0.1
143 0.1
144 0.12
145 0.12
146 0.08
147 0.08
148 0.08
149 0.08
150 0.07
151 0.08
152 0.07
153 0.07
154 0.1
155 0.11
156 0.13
157 0.15
158 0.18
159 0.17
160 0.19
161 0.21
162 0.2
163 0.2
164 0.18
165 0.18
166 0.17
167 0.17
168 0.16
169 0.13
170 0.11
171 0.1
172 0.1
173 0.07
174 0.07
175 0.07
176 0.08
177 0.09
178 0.11
179 0.14
180 0.17
181 0.18
182 0.17
183 0.17
184 0.23
185 0.27
186 0.28
187 0.29
188 0.27
189 0.27
190 0.27
191 0.26
192 0.2
193 0.16
194 0.14
195 0.11
196 0.11
197 0.1
198 0.1
199 0.11
200 0.11
201 0.1
202 0.13
203 0.16
204 0.17
205 0.24
206 0.26
207 0.27
208 0.3
209 0.34
210 0.36
211 0.34
212 0.38
213 0.33
214 0.32
215 0.32
216 0.29
217 0.27
218 0.21
219 0.21
220 0.15
221 0.12
222 0.1
223 0.08
224 0.08
225 0.07
226 0.06
227 0.05
228 0.06
229 0.06
230 0.07
231 0.07
232 0.08
233 0.08
234 0.08
235 0.1
236 0.08
237 0.09
238 0.1
239 0.11
240 0.1
241 0.1