Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BVI4

Protein Details
Accession A0A5M6BVI4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-47AGKVKSQCPKVEKQEKKKTPKGRAKKRLQYNRRYVEMHydrophilic
NLS Segment(s)
PositionSequence
20-37KVEKQEKKKTPKGRAKKR
Subcellular Location(s) nucl 14, mito 7.5, cyto_mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKKKTPKGRAKKRLQYNRRYVEMVEAIDGVILIIRRFSLLPITQIRQRHSRPRWQAKDEPATRRKVRINGSNELELDLEISVDGGLRECIRIHHGDGNFLGITWTFRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.52
4 0.54
5 0.56
6 0.65
7 0.68
8 0.74
9 0.76
10 0.79
11 0.82
12 0.85
13 0.88
14 0.89
15 0.88
16 0.88
17 0.89
18 0.89
19 0.89
20 0.9
21 0.91
22 0.91
23 0.92
24 0.92
25 0.91
26 0.9
27 0.89
28 0.85
29 0.78
30 0.69
31 0.58
32 0.52
33 0.44
34 0.34
35 0.24
36 0.17
37 0.13
38 0.11
39 0.11
40 0.06
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.05
49 0.07
50 0.07
51 0.11
52 0.14
53 0.16
54 0.19
55 0.23
56 0.25
57 0.3
58 0.34
59 0.4
60 0.43
61 0.51
62 0.58
63 0.66
64 0.71
65 0.7
66 0.73
67 0.7
68 0.75
69 0.72
70 0.71
71 0.65
72 0.66
73 0.61
74 0.6
75 0.58
76 0.54
77 0.55
78 0.54
79 0.54
80 0.54
81 0.55
82 0.52
83 0.47
84 0.41
85 0.34
86 0.25
87 0.2
88 0.12
89 0.08
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.06
97 0.06
98 0.07
99 0.08
100 0.1
101 0.14
102 0.16
103 0.19
104 0.25
105 0.26
106 0.28
107 0.28
108 0.3
109 0.26
110 0.23
111 0.2
112 0.13