Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C0H7

Protein Details
Accession A0A5M6C0H7   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKSIRSKAKMASRARKRQTSHHydrophilic
NLS Segment(s)
PositionSequence
10-10K
12-16ASRAR
78-110GPKDSGRIKWRLARGMPAKPKRGVMGGKNTRRR
Subcellular Location(s) cyto 3, mito 10, nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSIRSKAKMASRARKRQTSHYGITEAARTQRLSDKLLGKSKKEGEDATEETEEAAVEGEGEDAKMEETPKKISTSGPKDSGRIKWRLARGMPAKPKRGVMGGKNTRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.83
4 0.78
5 0.79
6 0.78
7 0.76
8 0.7
9 0.64
10 0.57
11 0.5
12 0.47
13 0.39
14 0.31
15 0.26
16 0.22
17 0.18
18 0.18
19 0.23
20 0.24
21 0.25
22 0.29
23 0.31
24 0.35
25 0.43
26 0.45
27 0.4
28 0.44
29 0.46
30 0.44
31 0.4
32 0.34
33 0.29
34 0.31
35 0.31
36 0.27
37 0.23
38 0.19
39 0.17
40 0.17
41 0.13
42 0.08
43 0.06
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.08
56 0.09
57 0.13
58 0.14
59 0.16
60 0.17
61 0.2
62 0.29
63 0.34
64 0.39
65 0.43
66 0.43
67 0.44
68 0.48
69 0.52
70 0.49
71 0.46
72 0.45
73 0.45
74 0.49
75 0.53
76 0.51
77 0.52
78 0.52
79 0.57
80 0.63
81 0.64
82 0.66
83 0.61
84 0.62
85 0.55
86 0.56
87 0.53
88 0.5
89 0.53
90 0.57