Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6C0C6

Protein Details
Accession A0A5M6C0C6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RLYTKGRILGHKRGKRNSRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
15-20HKRGKR
Subcellular Location(s) mito 14, cyto 10, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MAATRLYTKGRILGHKRGKRNSRPNQSLVQIEGVDSKEAARHYLGKRVAYVYKAKREINGSKVRVIWGRISRPHGNSGAAKAKFRTNLPAKVFGASVRIMLFPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.86
10 0.85
11 0.81
12 0.76
13 0.7
14 0.61
15 0.51
16 0.43
17 0.32
18 0.25
19 0.23
20 0.18
21 0.14
22 0.12
23 0.1
24 0.1
25 0.1
26 0.11
27 0.1
28 0.16
29 0.17
30 0.24
31 0.26
32 0.25
33 0.25
34 0.27
35 0.27
36 0.23
37 0.3
38 0.27
39 0.32
40 0.35
41 0.35
42 0.34
43 0.39
44 0.4
45 0.4
46 0.44
47 0.39
48 0.37
49 0.37
50 0.37
51 0.33
52 0.31
53 0.3
54 0.27
55 0.3
56 0.32
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.33
64 0.35
65 0.37
66 0.33
67 0.33
68 0.31
69 0.34
70 0.34
71 0.34
72 0.38
73 0.36
74 0.43
75 0.46
76 0.52
77 0.48
78 0.46
79 0.45
80 0.36
81 0.32
82 0.23
83 0.2
84 0.14
85 0.14
86 0.13