Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VJ75

Protein Details
Accession H1VJ75    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
418-442LLLYYRQQRQQQHRREEEEQRRRDGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 6.5, cyto_nucl 6.5, nucl 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MENHKQGIEKTASKAAGFIGRMYLRGDGVDQSFDQSKRWFERGISHGDAQSQHGLGLMMLHGYGMPKNIAMATDLFKAAAEQDYAPSQIELGVLYLDQGGAEDVRIANNYFELAARYGQIEAHYYLAEMVYNGVGRDKTCSMALGYYKNVAEKAEPLVSSWAEANQAYYYGDEELAFLEYVMAAEQGYERAQNNVAFILDPVQSRLPLPDWLPLPEWLGLRHTRSSLLDNQRLALMYWTRSSRQSNVDSQVKMGDYYFHGIGSEPDVNKAVQCYTGASDYSQSAQALWNLGWMHENGIGLTQDFHLAKRYYDQALEVNEEAYLPVTLSLLKLRLRSAWNTFTHGPIHSIQDDPKPKKDWSLSEWIANFLQDDQFYDDPYYDDIFDDTIGGTGPDGNPLEDDGIAESLIIVFIALSIVLLLYYRQQRQQQHRREEEEQRRRDGQPAAPALQGQQQGQGLFPQPGNPEWNNWVAGGIGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.31
4 0.28
5 0.24
6 0.24
7 0.23
8 0.25
9 0.25
10 0.24
11 0.18
12 0.18
13 0.19
14 0.15
15 0.16
16 0.18
17 0.16
18 0.19
19 0.24
20 0.24
21 0.26
22 0.26
23 0.32
24 0.35
25 0.39
26 0.37
27 0.34
28 0.42
29 0.44
30 0.48
31 0.46
32 0.43
33 0.41
34 0.41
35 0.41
36 0.35
37 0.33
38 0.25
39 0.2
40 0.18
41 0.17
42 0.13
43 0.12
44 0.09
45 0.06
46 0.06
47 0.06
48 0.05
49 0.06
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09
55 0.1
56 0.09
57 0.1
58 0.11
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.13
65 0.13
66 0.12
67 0.11
68 0.09
69 0.11
70 0.12
71 0.14
72 0.14
73 0.12
74 0.11
75 0.1
76 0.09
77 0.08
78 0.07
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.08
93 0.08
94 0.08
95 0.08
96 0.09
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.11
107 0.12
108 0.11
109 0.12
110 0.11
111 0.1
112 0.1
113 0.09
114 0.09
115 0.06
116 0.06
117 0.05
118 0.06
119 0.06
120 0.07
121 0.08
122 0.08
123 0.12
124 0.12
125 0.13
126 0.13
127 0.14
128 0.13
129 0.16
130 0.18
131 0.16
132 0.17
133 0.18
134 0.18
135 0.18
136 0.18
137 0.15
138 0.14
139 0.13
140 0.15
141 0.15
142 0.14
143 0.14
144 0.16
145 0.15
146 0.15
147 0.14
148 0.11
149 0.1
150 0.1
151 0.1
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.08
159 0.06
160 0.06
161 0.06
162 0.07
163 0.07
164 0.06
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.04
174 0.05
175 0.07
176 0.07
177 0.08
178 0.1
179 0.11
180 0.11
181 0.11
182 0.1
183 0.09
184 0.08
185 0.1
186 0.09
187 0.09
188 0.1
189 0.1
190 0.1
191 0.1
192 0.12
193 0.11
194 0.11
195 0.12
196 0.14
197 0.14
198 0.16
199 0.17
200 0.17
201 0.17
202 0.17
203 0.17
204 0.13
205 0.16
206 0.16
207 0.17
208 0.17
209 0.16
210 0.16
211 0.17
212 0.19
213 0.24
214 0.3
215 0.31
216 0.3
217 0.3
218 0.29
219 0.28
220 0.25
221 0.18
222 0.12
223 0.09
224 0.11
225 0.13
226 0.13
227 0.17
228 0.19
229 0.2
230 0.24
231 0.27
232 0.29
233 0.34
234 0.37
235 0.34
236 0.32
237 0.3
238 0.25
239 0.22
240 0.17
241 0.13
242 0.08
243 0.11
244 0.1
245 0.08
246 0.08
247 0.08
248 0.09
249 0.1
250 0.13
251 0.11
252 0.11
253 0.12
254 0.12
255 0.12
256 0.13
257 0.1
258 0.07
259 0.08
260 0.08
261 0.08
262 0.09
263 0.09
264 0.09
265 0.1
266 0.1
267 0.1
268 0.11
269 0.09
270 0.09
271 0.09
272 0.1
273 0.09
274 0.09
275 0.1
276 0.09
277 0.1
278 0.1
279 0.09
280 0.1
281 0.1
282 0.11
283 0.08
284 0.09
285 0.08
286 0.08
287 0.08
288 0.07
289 0.09
290 0.09
291 0.1
292 0.14
293 0.14
294 0.15
295 0.17
296 0.2
297 0.18
298 0.18
299 0.2
300 0.17
301 0.18
302 0.21
303 0.18
304 0.15
305 0.13
306 0.12
307 0.11
308 0.08
309 0.07
310 0.04
311 0.04
312 0.04
313 0.05
314 0.05
315 0.07
316 0.09
317 0.12
318 0.13
319 0.14
320 0.18
321 0.21
322 0.25
323 0.29
324 0.33
325 0.33
326 0.37
327 0.37
328 0.35
329 0.34
330 0.3
331 0.28
332 0.22
333 0.24
334 0.2
335 0.21
336 0.21
337 0.27
338 0.36
339 0.38
340 0.42
341 0.43
342 0.43
343 0.48
344 0.51
345 0.48
346 0.45
347 0.5
348 0.46
349 0.47
350 0.46
351 0.42
352 0.36
353 0.31
354 0.25
355 0.16
356 0.16
357 0.11
358 0.12
359 0.15
360 0.15
361 0.16
362 0.16
363 0.16
364 0.15
365 0.16
366 0.16
367 0.11
368 0.11
369 0.1
370 0.1
371 0.1
372 0.09
373 0.07
374 0.06
375 0.06
376 0.05
377 0.05
378 0.06
379 0.06
380 0.1
381 0.11
382 0.11
383 0.11
384 0.12
385 0.13
386 0.11
387 0.11
388 0.08
389 0.08
390 0.08
391 0.07
392 0.06
393 0.05
394 0.05
395 0.05
396 0.03
397 0.02
398 0.03
399 0.03
400 0.03
401 0.02
402 0.03
403 0.03
404 0.03
405 0.03
406 0.04
407 0.09
408 0.16
409 0.2
410 0.26
411 0.34
412 0.44
413 0.55
414 0.65
415 0.7
416 0.74
417 0.8
418 0.82
419 0.82
420 0.84
421 0.84
422 0.84
423 0.8
424 0.76
425 0.73
426 0.67
427 0.66
428 0.61
429 0.55
430 0.54
431 0.53
432 0.49
433 0.44
434 0.43
435 0.38
436 0.38
437 0.35
438 0.27
439 0.25
440 0.25
441 0.24
442 0.24
443 0.26
444 0.22
445 0.23
446 0.22
447 0.22
448 0.23
449 0.26
450 0.32
451 0.29
452 0.31
453 0.32
454 0.35
455 0.32
456 0.29
457 0.26