Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VBN8

Protein Details
Accession H1VBN8    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-37LPPRPVLARKRPPIHNRLRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039196  Fmc1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033615  P:mitochondrial proton-transporting ATP synthase complex assembly  
KEGG chig:CH63R_14122  -  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
Amino Acid Sequences MTAAPHLRSIYRSLLRELPPRPVLARKRPPIHNRLRASFAPTKDNSLEADTAAVAAAEAEQLAAYLRAQRTYVTLLERYNPGMDMDEEERVRLSARRVGMDLPKEFKDRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.5
4 0.48
5 0.47
6 0.43
7 0.43
8 0.42
9 0.44
10 0.47
11 0.51
12 0.59
13 0.6
14 0.65
15 0.73
16 0.78
17 0.79
18 0.81
19 0.8
20 0.75
21 0.7
22 0.68
23 0.59
24 0.59
25 0.54
26 0.45
27 0.42
28 0.37
29 0.37
30 0.32
31 0.32
32 0.25
33 0.22
34 0.2
35 0.13
36 0.13
37 0.09
38 0.08
39 0.07
40 0.05
41 0.03
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.03
52 0.07
53 0.07
54 0.08
55 0.09
56 0.09
57 0.11
58 0.13
59 0.15
60 0.14
61 0.16
62 0.16
63 0.19
64 0.19
65 0.19
66 0.17
67 0.16
68 0.13
69 0.13
70 0.13
71 0.14
72 0.15
73 0.18
74 0.17
75 0.17
76 0.17
77 0.16
78 0.17
79 0.16
80 0.17
81 0.18
82 0.21
83 0.23
84 0.24
85 0.28
86 0.34
87 0.38
88 0.4
89 0.39
90 0.41
91 0.42