Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6C3G4

Protein Details
Accession A0A5M6C3G4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-83ITHAEKNWLRRKLRRKGYSEVVDNHydrophilic
NLS Segment(s)
PositionSequence
70-74RKLRR
Subcellular Location(s) nucl 11, cyto_nucl 8, mito 4, cyto 3, plas 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTNDDGSIVSTSDQICISSPSWDEIIKIILTLIIAEIIMGLIFICVRWKRHQVDHRHGITHAEKNWLRRKLRRKGYSEVVDND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.13
5 0.13
6 0.13
7 0.13
8 0.14
9 0.15
10 0.15
11 0.14
12 0.12
13 0.13
14 0.11
15 0.1
16 0.08
17 0.07
18 0.06
19 0.06
20 0.05
21 0.03
22 0.03
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.06
33 0.07
34 0.11
35 0.15
36 0.22
37 0.26
38 0.36
39 0.44
40 0.5
41 0.58
42 0.65
43 0.64
44 0.59
45 0.55
46 0.52
47 0.49
48 0.45
49 0.37
50 0.37
51 0.36
52 0.43
53 0.51
54 0.54
55 0.56
56 0.6
57 0.68
58 0.7
59 0.79
60 0.8
61 0.78
62 0.78
63 0.81
64 0.8