Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C6R5

Protein Details
Accession A0A5M6C6R5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-58YILWRKRETERKRFMRRAWRARFMTHydrophilic
NLS Segment(s)
PositionSequence
44-47RKRF
Subcellular Location(s) plas 16, mito 4, cyto 2, extr 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGNATNLITEHQLIFLITLGALLFTIAIATLTIYILWRKRETERKRFMRRAWRARFMTGVTGLEEDGHEEIVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.03
18 0.03
19 0.03
20 0.04
21 0.06
22 0.09
23 0.11
24 0.12
25 0.14
26 0.21
27 0.31
28 0.4
29 0.48
30 0.57
31 0.65
32 0.74
33 0.79
34 0.8
35 0.81
36 0.83
37 0.83
38 0.81
39 0.8
40 0.73
41 0.68
42 0.64
43 0.54
44 0.48
45 0.39
46 0.31
47 0.23
48 0.2
49 0.18
50 0.16
51 0.14
52 0.12
53 0.1