Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C2P1

Protein Details
Accession A0A5M6C2P1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-151EDKLAKYRIERRRARLREKRERERILPBasic
NLS Segment(s)
PositionSequence
131-147YRIERRRARLREKRERE
Subcellular Location(s) mito 17, nucl 4, extr 3, cyto 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MSLNRNSLRLFALPRTLPSTQPSLPRSFHSSIFRNRPTSTSGGTSGAGHHVTHTTSHPSHLHAHPRPPSPKKPSAHAVWYREIVPAMLPIFLISTTLFLSLSLLRTYLSHSKSLSEAETRIAELEDKLAKYRIERRRARLREKRERERILPLVVEKVLQKVGVVGGEEEESVVEEREREEERKRAMARLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.35
4 0.33
5 0.32
6 0.35
7 0.32
8 0.39
9 0.4
10 0.39
11 0.4
12 0.42
13 0.46
14 0.42
15 0.44
16 0.43
17 0.46
18 0.5
19 0.58
20 0.59
21 0.56
22 0.55
23 0.51
24 0.48
25 0.45
26 0.38
27 0.32
28 0.28
29 0.25
30 0.25
31 0.23
32 0.2
33 0.19
34 0.17
35 0.13
36 0.12
37 0.12
38 0.11
39 0.13
40 0.14
41 0.17
42 0.16
43 0.2
44 0.2
45 0.22
46 0.27
47 0.3
48 0.38
49 0.36
50 0.43
51 0.45
52 0.52
53 0.58
54 0.59
55 0.64
56 0.62
57 0.67
58 0.62
59 0.61
60 0.6
61 0.55
62 0.57
63 0.55
64 0.5
65 0.44
66 0.44
67 0.39
68 0.33
69 0.29
70 0.2
71 0.13
72 0.11
73 0.08
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.1
94 0.15
95 0.17
96 0.17
97 0.18
98 0.19
99 0.19
100 0.2
101 0.19
102 0.14
103 0.13
104 0.13
105 0.13
106 0.12
107 0.12
108 0.11
109 0.1
110 0.08
111 0.1
112 0.11
113 0.11
114 0.12
115 0.14
116 0.15
117 0.18
118 0.28
119 0.34
120 0.42
121 0.48
122 0.56
123 0.65
124 0.73
125 0.8
126 0.8
127 0.82
128 0.83
129 0.87
130 0.89
131 0.88
132 0.86
133 0.79
134 0.78
135 0.71
136 0.62
137 0.55
138 0.45
139 0.39
140 0.32
141 0.3
142 0.22
143 0.19
144 0.17
145 0.14
146 0.13
147 0.1
148 0.11
149 0.11
150 0.11
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.08
162 0.09
163 0.13
164 0.18
165 0.2
166 0.26
167 0.33
168 0.38
169 0.46
170 0.48