Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C1N1

Protein Details
Accession A0A5M6C1N1   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-31STSPNCKGKACKKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8, mito 12, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MIIGSTSPNCKGKACKKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKTKHQLSLKRCKHFELGGDKKQRGAAINF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.69
4 0.79
5 0.86
6 0.85
7 0.85
8 0.85
9 0.87
10 0.83
11 0.84
12 0.84
13 0.8
14 0.75
15 0.7
16 0.61
17 0.55
18 0.52
19 0.51
20 0.51
21 0.49
22 0.49
23 0.5
24 0.53
25 0.56
26 0.57
27 0.53
28 0.53
29 0.58
30 0.59
31 0.61
32 0.59
33 0.58
34 0.58
35 0.59
36 0.5
37 0.45
38 0.41
39 0.34
40 0.35
41 0.37
42 0.35
43 0.3
44 0.37
45 0.41
46 0.49
47 0.58
48 0.61
49 0.6
50 0.64
51 0.71
52 0.72
53 0.7
54 0.67
55 0.63
56 0.59
57 0.58
58 0.54
59 0.49
60 0.47
61 0.41
62 0.39
63 0.41
64 0.41
65 0.43
66 0.51
67 0.56
68 0.6
69 0.7
70 0.74
71 0.77
72 0.74
73 0.69
74 0.64
75 0.58
76 0.55
77 0.55
78 0.55
79 0.55
80 0.62
81 0.59
82 0.56
83 0.56
84 0.51