Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6BWI7

Protein Details
Accession A0A5M6BWI7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-127PLDLRYKKTRAIRRRLTHKESHAITEKQHKKQIHFPQRKYALKAHydrophilic
NLS Segment(s)
PositionSequence
90-102KKTRAIRRRLTHK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MASSSSKIRAFELQSKSKTDLLTQLNELKTELASLRVQKIAGGSASKLTKINTVRKSIARVLTVINHKQRDNLREFYKKSKYLPLDLRYKKTRAIRRRLTHKESHAITEKQHKKQIHFPQRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.53
4 0.5
5 0.45
6 0.38
7 0.38
8 0.33
9 0.34
10 0.33
11 0.36
12 0.33
13 0.33
14 0.31
15 0.24
16 0.19
17 0.17
18 0.14
19 0.11
20 0.13
21 0.15
22 0.17
23 0.17
24 0.17
25 0.16
26 0.17
27 0.15
28 0.13
29 0.12
30 0.1
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.18
37 0.23
38 0.31
39 0.32
40 0.36
41 0.38
42 0.39
43 0.42
44 0.41
45 0.38
46 0.3
47 0.26
48 0.23
49 0.24
50 0.27
51 0.28
52 0.29
53 0.28
54 0.28
55 0.32
56 0.35
57 0.36
58 0.37
59 0.37
60 0.38
61 0.43
62 0.46
63 0.49
64 0.53
65 0.5
66 0.48
67 0.5
68 0.47
69 0.48
70 0.53
71 0.51
72 0.54
73 0.56
74 0.61
75 0.58
76 0.56
77 0.55
78 0.56
79 0.6
80 0.6
81 0.65
82 0.69
83 0.73
84 0.82
85 0.86
86 0.84
87 0.82
88 0.78
89 0.76
90 0.68
91 0.65
92 0.61
93 0.54
94 0.5
95 0.53
96 0.56
97 0.55
98 0.6
99 0.58
100 0.56
101 0.64
102 0.71
103 0.72
104 0.74
105 0.71
106 0.75
107 0.8