Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6C7B3

Protein Details
Accession A0A5M6C7B3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-32DFDFKKPFTSSKKKSKSKITTPSSNKSSHydrophilic
NLS Segment(s)
PositionSequence
17-18KK
Subcellular Location(s) mito_nucl 10.833, nucl 10.5, mito 9, cyto_nucl 8.666, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MTTPDFDFKKPFTSSKKKSKSKITTPSSNKSSTSPGGRKSEGWTPEMRLKLFEKFVELADVKWDEVAIKMGNGYTGKQCREQWQRATGKKIKKALAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.75
4 0.77
5 0.81
6 0.85
7 0.85
8 0.85
9 0.86
10 0.83
11 0.82
12 0.81
13 0.81
14 0.75
15 0.67
16 0.58
17 0.5
18 0.46
19 0.4
20 0.41
21 0.37
22 0.38
23 0.4
24 0.4
25 0.39
26 0.37
27 0.4
28 0.33
29 0.31
30 0.27
31 0.25
32 0.29
33 0.3
34 0.26
35 0.22
36 0.22
37 0.22
38 0.23
39 0.19
40 0.17
41 0.15
42 0.15
43 0.17
44 0.16
45 0.13
46 0.14
47 0.15
48 0.12
49 0.11
50 0.11
51 0.07
52 0.08
53 0.1
54 0.07
55 0.06
56 0.07
57 0.07
58 0.09
59 0.1
60 0.11
61 0.16
62 0.21
63 0.24
64 0.29
65 0.31
66 0.39
67 0.48
68 0.55
69 0.54
70 0.59
71 0.66
72 0.67
73 0.75
74 0.73
75 0.73
76 0.73
77 0.74
78 0.7