Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6BZF0

Protein Details
Accession A0A5M6BZF0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41AQAGSKAGKKKKWSKGKVKDKANNAVIHydrophilic
NLS Segment(s)
PositionSequence
11-35KAAAAQAGSKAGKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPQVKSKAQKAAAAQAGSKAGKKKKWSKGKVKDKANNAVIVDKPVFDRIVKEVPTYKLISQSVLIDRMKINGSLARRAIAYLEKEGLIKRVVHHHAQLIYTRATAATTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.33
4 0.35
5 0.31
6 0.31
7 0.3
8 0.32
9 0.36
10 0.46
11 0.54
12 0.6
13 0.7
14 0.77
15 0.81
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.82
23 0.73
24 0.65
25 0.55
26 0.48
27 0.38
28 0.33
29 0.27
30 0.18
31 0.16
32 0.14
33 0.14
34 0.11
35 0.12
36 0.12
37 0.16
38 0.16
39 0.17
40 0.19
41 0.2
42 0.23
43 0.23
44 0.2
45 0.2
46 0.2
47 0.19
48 0.17
49 0.17
50 0.16
51 0.18
52 0.18
53 0.15
54 0.15
55 0.16
56 0.16
57 0.14
58 0.13
59 0.12
60 0.15
61 0.18
62 0.18
63 0.17
64 0.16
65 0.16
66 0.17
67 0.18
68 0.18
69 0.16
70 0.17
71 0.16
72 0.17
73 0.18
74 0.19
75 0.17
76 0.16
77 0.16
78 0.23
79 0.27
80 0.3
81 0.32
82 0.35
83 0.35
84 0.36
85 0.37
86 0.32
87 0.29
88 0.25
89 0.23
90 0.18