Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BYW6

Protein Details
Accession A0A5M6BYW6   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
195-217QKSTWGYKKRLSREVKQKRKEFWHydrophilic
NLS Segment(s)
PositionSequence
209-213VKQKR
Subcellular Location(s) cyto 3, cyto_nucl 4.5, mito 19, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Amino Acid Sequences MACSTLASSSRTLPRSTFTLSPLGSTRGVLHRARPPRIPILPSPHTPKTPLPTSGTSHPIDPKVHTNGQLPPSTTSSTSLEDSDGLTFHHSPPPSLPSYTNGQVPSLLKWLGGESVRLTGEEGAPVIKERKVFGGRAEWSEEVVSRIKELRAQGLSRKAIGETLQIPAELHRLIPRIAPQTPIQSAEKASELEAQKSTWGYKKRLSREVKQKRKEFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.36
4 0.33
5 0.28
6 0.33
7 0.31
8 0.32
9 0.31
10 0.3
11 0.26
12 0.24
13 0.25
14 0.23
15 0.28
16 0.27
17 0.31
18 0.36
19 0.45
20 0.49
21 0.5
22 0.5
23 0.53
24 0.57
25 0.55
26 0.53
27 0.53
28 0.53
29 0.53
30 0.56
31 0.52
32 0.49
33 0.48
34 0.46
35 0.44
36 0.44
37 0.43
38 0.4
39 0.39
40 0.41
41 0.42
42 0.43
43 0.36
44 0.34
45 0.34
46 0.32
47 0.3
48 0.29
49 0.3
50 0.31
51 0.33
52 0.33
53 0.32
54 0.34
55 0.37
56 0.36
57 0.32
58 0.29
59 0.29
60 0.28
61 0.25
62 0.22
63 0.2
64 0.2
65 0.2
66 0.17
67 0.15
68 0.14
69 0.14
70 0.11
71 0.09
72 0.07
73 0.09
74 0.09
75 0.09
76 0.13
77 0.13
78 0.13
79 0.14
80 0.18
81 0.18
82 0.18
83 0.18
84 0.17
85 0.21
86 0.22
87 0.23
88 0.2
89 0.18
90 0.18
91 0.18
92 0.16
93 0.14
94 0.13
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.07
102 0.09
103 0.09
104 0.09
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.05
111 0.05
112 0.06
113 0.07
114 0.08
115 0.09
116 0.1
117 0.15
118 0.17
119 0.18
120 0.19
121 0.25
122 0.25
123 0.26
124 0.29
125 0.23
126 0.22
127 0.22
128 0.2
129 0.15
130 0.15
131 0.13
132 0.11
133 0.13
134 0.12
135 0.15
136 0.16
137 0.2
138 0.21
139 0.23
140 0.27
141 0.33
142 0.34
143 0.32
144 0.31
145 0.26
146 0.24
147 0.22
148 0.2
149 0.14
150 0.15
151 0.14
152 0.14
153 0.14
154 0.13
155 0.15
156 0.12
157 0.11
158 0.12
159 0.14
160 0.14
161 0.16
162 0.21
163 0.24
164 0.25
165 0.27
166 0.26
167 0.31
168 0.32
169 0.34
170 0.31
171 0.27
172 0.27
173 0.26
174 0.26
175 0.2
176 0.19
177 0.22
178 0.22
179 0.23
180 0.23
181 0.22
182 0.22
183 0.23
184 0.26
185 0.27
186 0.32
187 0.34
188 0.4
189 0.5
190 0.56
191 0.64
192 0.69
193 0.71
194 0.76
195 0.82
196 0.86
197 0.86