Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C6J7

Protein Details
Accession A0A5M6C6J7   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-30YAHAGPSRPRDHHKKPSRPFVSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 3, cyto_pero 2, extr 2, mito 15, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036551  Flavin_trans-like  
IPR003382  Flavoprotein  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF02441  Flavoprotein  
Amino Acid Sequences MQSDYPHYAHAGPSRPRDHHKKPSRPFVSAEHRPEGADGIFRVVLITSGSVASIKAPDIVGALMKSPDTAVQVVATKASSHFYTQDVVDQAVRKAVSGDGEGSSDDDMGVRVWTDEDEWSDWKKIGDPILHIELRRWADLVVVAPCSADMLAKIAGGLCDSLATSLLRALSPFTPVILCPAMNTNMYSHPFTAKHLKVVREELGYLISGPQDGGKLACGDEGAGKMTDWRDIVSLIEGYASAYKMQFPAPNRSLSKPSTSESLSHTPDVYADLPREVPTITPPPRPPTPPTPNRLSQLMINDPYSDANPPQRELPRGQGALESVTGCGTRKKDESASVKDWRSMADGNGGTGVFWTRKWWIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.64
4 0.69
5 0.73
6 0.76
7 0.8
8 0.82
9 0.84
10 0.89
11 0.87
12 0.8
13 0.74
14 0.72
15 0.71
16 0.7
17 0.67
18 0.6
19 0.54
20 0.51
21 0.47
22 0.4
23 0.31
24 0.24
25 0.17
26 0.16
27 0.16
28 0.15
29 0.14
30 0.12
31 0.11
32 0.09
33 0.09
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.1
48 0.09
49 0.1
50 0.09
51 0.09
52 0.09
53 0.08
54 0.09
55 0.1
56 0.1
57 0.1
58 0.11
59 0.13
60 0.13
61 0.13
62 0.12
63 0.1
64 0.11
65 0.13
66 0.12
67 0.12
68 0.13
69 0.14
70 0.16
71 0.15
72 0.18
73 0.17
74 0.17
75 0.18
76 0.18
77 0.17
78 0.18
79 0.18
80 0.14
81 0.14
82 0.13
83 0.12
84 0.12
85 0.13
86 0.1
87 0.11
88 0.11
89 0.1
90 0.1
91 0.08
92 0.07
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.07
103 0.08
104 0.1
105 0.13
106 0.15
107 0.16
108 0.16
109 0.15
110 0.17
111 0.18
112 0.2
113 0.19
114 0.19
115 0.22
116 0.27
117 0.28
118 0.25
119 0.24
120 0.25
121 0.25
122 0.23
123 0.19
124 0.14
125 0.13
126 0.14
127 0.15
128 0.1
129 0.09
130 0.09
131 0.08
132 0.08
133 0.07
134 0.06
135 0.05
136 0.03
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.07
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.1
164 0.09
165 0.09
166 0.07
167 0.09
168 0.1
169 0.1
170 0.11
171 0.09
172 0.12
173 0.14
174 0.15
175 0.13
176 0.15
177 0.15
178 0.17
179 0.25
180 0.22
181 0.27
182 0.3
183 0.32
184 0.32
185 0.35
186 0.34
187 0.26
188 0.26
189 0.2
190 0.16
191 0.14
192 0.11
193 0.08
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.06
204 0.06
205 0.05
206 0.05
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.08
213 0.09
214 0.1
215 0.1
216 0.1
217 0.09
218 0.09
219 0.1
220 0.09
221 0.09
222 0.07
223 0.07
224 0.06
225 0.06
226 0.07
227 0.07
228 0.06
229 0.06
230 0.07
231 0.08
232 0.1
233 0.14
234 0.16
235 0.25
236 0.27
237 0.34
238 0.36
239 0.39
240 0.42
241 0.4
242 0.43
243 0.36
244 0.35
245 0.32
246 0.31
247 0.29
248 0.3
249 0.34
250 0.31
251 0.29
252 0.28
253 0.24
254 0.23
255 0.24
256 0.19
257 0.15
258 0.13
259 0.14
260 0.14
261 0.15
262 0.15
263 0.13
264 0.12
265 0.14
266 0.23
267 0.25
268 0.32
269 0.35
270 0.41
271 0.45
272 0.49
273 0.51
274 0.52
275 0.59
276 0.61
277 0.63
278 0.64
279 0.65
280 0.64
281 0.59
282 0.51
283 0.44
284 0.41
285 0.41
286 0.37
287 0.32
288 0.29
289 0.27
290 0.27
291 0.24
292 0.21
293 0.18
294 0.23
295 0.25
296 0.26
297 0.32
298 0.36
299 0.39
300 0.4
301 0.44
302 0.44
303 0.43
304 0.42
305 0.37
306 0.33
307 0.3
308 0.28
309 0.21
310 0.13
311 0.13
312 0.13
313 0.12
314 0.16
315 0.17
316 0.22
317 0.24
318 0.29
319 0.33
320 0.41
321 0.49
322 0.52
323 0.56
324 0.59
325 0.59
326 0.57
327 0.53
328 0.45
329 0.41
330 0.35
331 0.29
332 0.29
333 0.27
334 0.24
335 0.25
336 0.23
337 0.19
338 0.18
339 0.19
340 0.12
341 0.12
342 0.15