Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C736

Protein Details
Accession A0A5M6C736   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MPRSPSPRRDRERDRDRSRSRSPPRHHRTKQPRELSFYKKBasic
NLS Segment(s)
PositionSequence
6-33SPRRDRERDRDRSRSRSPPRHHRTKQPR
138-184GGRDRERDDRRDDRRDRERDHRRDREREQPRREKEPQPPTGPAERRP
Subcellular Location(s) cyto_nucl 12.5, mito 4, nucl 22
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
CDD cd01791  Ubl_UBL5  
Amino Acid Sequences MPRSPSPRRDRERDRDRSRSRSPPRHHRTKQPRELSFYKKSSGPSSGVGSFSSRRDPLEEDQSTSKERAERRERGEVPARFGGTREQGVRNTMGTVGGQAGSVGSLKRTGDPLDRMGVRGDPSRDRDESRREGYGGSGGRDRERDDRRDDRRDRERDHRRDREREQPRREKEPQPPTGPAERRPPAAPPTAAPSVGSMRLIEVIANDRMGRKVRIKCLPTDTVGDLKRLIAAQTGTSAQKIQLKKWFVSSITLFGASTYTNFKDHIALQDYEINDGMSLEMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.89
4 0.88
5 0.86
6 0.86
7 0.86
8 0.85
9 0.86
10 0.86
11 0.87
12 0.9
13 0.88
14 0.89
15 0.89
16 0.9
17 0.9
18 0.89
19 0.85
20 0.82
21 0.82
22 0.79
23 0.77
24 0.69
25 0.62
26 0.55
27 0.52
28 0.48
29 0.45
30 0.39
31 0.33
32 0.34
33 0.33
34 0.3
35 0.27
36 0.26
37 0.25
38 0.24
39 0.26
40 0.23
41 0.22
42 0.24
43 0.28
44 0.29
45 0.36
46 0.35
47 0.34
48 0.36
49 0.37
50 0.37
51 0.33
52 0.31
53 0.26
54 0.29
55 0.35
56 0.41
57 0.47
58 0.5
59 0.6
60 0.59
61 0.61
62 0.67
63 0.59
64 0.55
65 0.51
66 0.46
67 0.36
68 0.35
69 0.31
70 0.25
71 0.26
72 0.24
73 0.23
74 0.23
75 0.25
76 0.25
77 0.22
78 0.19
79 0.16
80 0.13
81 0.1
82 0.09
83 0.08
84 0.07
85 0.06
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.04
92 0.06
93 0.07
94 0.08
95 0.09
96 0.11
97 0.14
98 0.17
99 0.18
100 0.21
101 0.2
102 0.2
103 0.2
104 0.19
105 0.17
106 0.18
107 0.18
108 0.18
109 0.22
110 0.25
111 0.26
112 0.28
113 0.31
114 0.35
115 0.38
116 0.38
117 0.35
118 0.31
119 0.29
120 0.26
121 0.26
122 0.2
123 0.16
124 0.15
125 0.15
126 0.15
127 0.16
128 0.18
129 0.22
130 0.25
131 0.28
132 0.33
133 0.41
134 0.47
135 0.57
136 0.59
137 0.59
138 0.65
139 0.68
140 0.67
141 0.68
142 0.72
143 0.72
144 0.78
145 0.8
146 0.78
147 0.79
148 0.78
149 0.78
150 0.78
151 0.78
152 0.78
153 0.78
154 0.75
155 0.76
156 0.78
157 0.75
158 0.74
159 0.74
160 0.7
161 0.65
162 0.62
163 0.57
164 0.6
165 0.55
166 0.5
167 0.49
168 0.44
169 0.42
170 0.4
171 0.39
172 0.34
173 0.36
174 0.32
175 0.24
176 0.28
177 0.26
178 0.26
179 0.22
180 0.2
181 0.18
182 0.18
183 0.17
184 0.11
185 0.1
186 0.11
187 0.1
188 0.09
189 0.07
190 0.1
191 0.1
192 0.11
193 0.11
194 0.11
195 0.14
196 0.17
197 0.2
198 0.25
199 0.31
200 0.39
201 0.47
202 0.49
203 0.51
204 0.55
205 0.55
206 0.49
207 0.46
208 0.4
209 0.39
210 0.37
211 0.33
212 0.27
213 0.23
214 0.23
215 0.19
216 0.17
217 0.13
218 0.12
219 0.11
220 0.13
221 0.16
222 0.15
223 0.15
224 0.16
225 0.16
226 0.22
227 0.24
228 0.27
229 0.33
230 0.37
231 0.37
232 0.42
233 0.43
234 0.38
235 0.42
236 0.38
237 0.34
238 0.31
239 0.3
240 0.24
241 0.2
242 0.2
243 0.14
244 0.14
245 0.15
246 0.15
247 0.15
248 0.16
249 0.17
250 0.2
251 0.22
252 0.27
253 0.28
254 0.27
255 0.28
256 0.32
257 0.32
258 0.3
259 0.28
260 0.21
261 0.16
262 0.15