Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C8N8

Protein Details
Accession A0A5M6C8N8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-38TDEPRRKLRSPPPPPGHIKPBasic
40-62ENRNHSAMPKRNRKRFDDRPFLTHydrophilic
NLS Segment(s)
PositionSequence
22-54PRRKLRSPPPPPGHIKPIENRNHSAMPKRNRKR
Subcellular Location(s) cyto_nucl 9, mito 10, nucl 14
Family & Domain DBs
Amino Acid Sequences MKSASRPNVRFSKPPPSYTDEPRRKLRSPPPPPGHIKPIENRNHSAMPKRNRKRFDDRPFLTVPWMDYYEPPNTTEWFRPTPKSLPTILPYTTKWKLRNPNLKTWAGMKAYYGNPMMGGMGGMYPGMGMGGMGMGMPLYGMGMGMGGMGMMGSPYGMMGGGYGMPRYAPGMYGGYGGYGGYGGGMYDPMIGGYGAPSAASFVDDNPDAHRIEHAYRQSAPDSYGIGMGMMGGGMGINTLPGSQVLLYGRGMPYNVSSFSNVPSFDAYPVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.6
4 0.6
5 0.63
6 0.68
7 0.67
8 0.68
9 0.74
10 0.75
11 0.7
12 0.74
13 0.74
14 0.74
15 0.74
16 0.78
17 0.76
18 0.77
19 0.81
20 0.78
21 0.77
22 0.71
23 0.68
24 0.64
25 0.67
26 0.68
27 0.65
28 0.62
29 0.59
30 0.59
31 0.56
32 0.58
33 0.57
34 0.58
35 0.64
36 0.71
37 0.74
38 0.75
39 0.8
40 0.81
41 0.83
42 0.83
43 0.83
44 0.75
45 0.72
46 0.68
47 0.6
48 0.53
49 0.43
50 0.34
51 0.26
52 0.26
53 0.21
54 0.19
55 0.22
56 0.23
57 0.23
58 0.22
59 0.2
60 0.2
61 0.22
62 0.25
63 0.26
64 0.29
65 0.31
66 0.33
67 0.36
68 0.39
69 0.39
70 0.39
71 0.36
72 0.34
73 0.34
74 0.34
75 0.31
76 0.29
77 0.28
78 0.31
79 0.34
80 0.36
81 0.36
82 0.41
83 0.49
84 0.57
85 0.65
86 0.63
87 0.68
88 0.69
89 0.66
90 0.6
91 0.52
92 0.48
93 0.39
94 0.33
95 0.24
96 0.22
97 0.21
98 0.23
99 0.2
100 0.14
101 0.13
102 0.13
103 0.12
104 0.07
105 0.06
106 0.03
107 0.03
108 0.03
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.01
116 0.01
117 0.01
118 0.02
119 0.02
120 0.02
121 0.02
122 0.01
123 0.02
124 0.01
125 0.01
126 0.01
127 0.01
128 0.01
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.01
135 0.01
136 0.01
137 0.01
138 0.01
139 0.01
140 0.01
141 0.01
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.03
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.06
157 0.07
158 0.08
159 0.09
160 0.08
161 0.07
162 0.07
163 0.07
164 0.05
165 0.04
166 0.03
167 0.03
168 0.03
169 0.02
170 0.02
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.06
187 0.06
188 0.06
189 0.09
190 0.1
191 0.1
192 0.12
193 0.15
194 0.14
195 0.14
196 0.15
197 0.15
198 0.17
199 0.24
200 0.25
201 0.26
202 0.27
203 0.3
204 0.3
205 0.29
206 0.27
207 0.22
208 0.2
209 0.17
210 0.16
211 0.13
212 0.11
213 0.09
214 0.07
215 0.06
216 0.04
217 0.03
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.03
225 0.03
226 0.03
227 0.04
228 0.05
229 0.05
230 0.08
231 0.09
232 0.11
233 0.12
234 0.14
235 0.15
236 0.15
237 0.15
238 0.14
239 0.16
240 0.17
241 0.19
242 0.18
243 0.2
244 0.2
245 0.23
246 0.25
247 0.23
248 0.21
249 0.23
250 0.22