Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C4V1

Protein Details
Accession A0A5M6C4V1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKSPWRLSPTRKANQRKRLRQVDSVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 13.5, mito 24.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPTSFVSGGLLWKSPWRLSPTRKANQRKRLRQVDSVISAVAESGVTTRSLVKALELPTEEEMDPKNKYTTFSKYHKGYRKSSHFVPKWTRLTLRQNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.2
5 0.22
6 0.21
7 0.23
8 0.27
9 0.34
10 0.4
11 0.5
12 0.57
13 0.62
14 0.71
15 0.77
16 0.8
17 0.83
18 0.87
19 0.87
20 0.87
21 0.88
22 0.83
23 0.79
24 0.74
25 0.69
26 0.6
27 0.5
28 0.4
29 0.3
30 0.24
31 0.17
32 0.12
33 0.06
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.09
45 0.1
46 0.12
47 0.12
48 0.13
49 0.14
50 0.16
51 0.15
52 0.13
53 0.13
54 0.14
55 0.15
56 0.15
57 0.16
58 0.15
59 0.18
60 0.21
61 0.27
62 0.32
63 0.36
64 0.43
65 0.47
66 0.56
67 0.62
68 0.64
69 0.65
70 0.68
71 0.72
72 0.7
73 0.72
74 0.74
75 0.69
76 0.72
77 0.73
78 0.72
79 0.69
80 0.68
81 0.65
82 0.62
83 0.68
84 0.69
85 0.71