Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LBT0

Protein Details
Accession E2LBT0   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-54TPLPVKGSVKRRMRKGRIKKTETEMHydrophilic
NLS Segment(s)
PositionSequence
37-49SVKRRMRKGRIKK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 7.5, cysk 3
Family & Domain DBs
KEGG mpr:MPER_03621  -  
Amino Acid Sequences YGGELKLDQYMIQSLTFNSNPKEGHEDPYTPLPVKGSVKRRMRKGRIKKTETEMETETLSDLSRTCSESGSSVSDHSEMSVAGEMPGGTVRKPEMEWTLEETEDGRGVVRFHFLDQVAEKDEEEPEGNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.2
4 0.22
5 0.21
6 0.24
7 0.23
8 0.26
9 0.33
10 0.29
11 0.32
12 0.33
13 0.33
14 0.32
15 0.37
16 0.37
17 0.29
18 0.28
19 0.23
20 0.24
21 0.28
22 0.32
23 0.35
24 0.42
25 0.51
26 0.57
27 0.66
28 0.72
29 0.77
30 0.81
31 0.83
32 0.85
33 0.86
34 0.85
35 0.8
36 0.76
37 0.75
38 0.65
39 0.58
40 0.48
41 0.38
42 0.33
43 0.28
44 0.21
45 0.13
46 0.11
47 0.07
48 0.06
49 0.07
50 0.08
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.09
64 0.08
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.07
74 0.07
75 0.06
76 0.07
77 0.08
78 0.09
79 0.1
80 0.13
81 0.14
82 0.16
83 0.18
84 0.22
85 0.24
86 0.22
87 0.22
88 0.2
89 0.17
90 0.15
91 0.14
92 0.09
93 0.08
94 0.09
95 0.09
96 0.13
97 0.12
98 0.13
99 0.17
100 0.17
101 0.2
102 0.21
103 0.24
104 0.24
105 0.24
106 0.23
107 0.21
108 0.21
109 0.19