Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C5L9

Protein Details
Accession A0A5M6C5L9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-144TAPQPEPSARRKRSNQPAYPYKQYKYKPKRAAPTSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MLVKQLVLVLSFASLGFAYHGAAGPACTGSGACTYPDGDTTVNGFCSPNGFCADNGARCANDDNCYNYCGNGICGGNGATCTTNEPFTHGQGAVACNTDAGATCSAGVCTAPQPEPSARRKRSNQPAYPYKQYKYKPKRAAPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.06
17 0.08
18 0.09
19 0.08
20 0.09
21 0.1
22 0.1
23 0.11
24 0.12
25 0.1
26 0.1
27 0.12
28 0.11
29 0.11
30 0.11
31 0.11
32 0.09
33 0.11
34 0.11
35 0.1
36 0.12
37 0.12
38 0.12
39 0.17
40 0.2
41 0.18
42 0.2
43 0.19
44 0.17
45 0.16
46 0.19
47 0.15
48 0.15
49 0.15
50 0.17
51 0.17
52 0.19
53 0.18
54 0.15
55 0.15
56 0.13
57 0.12
58 0.11
59 0.1
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.08
66 0.05
67 0.06
68 0.08
69 0.08
70 0.1
71 0.1
72 0.14
73 0.15
74 0.15
75 0.17
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.12
82 0.1
83 0.08
84 0.08
85 0.08
86 0.07
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.07
97 0.1
98 0.11
99 0.12
100 0.16
101 0.21
102 0.28
103 0.37
104 0.45
105 0.49
106 0.57
107 0.64
108 0.71
109 0.78
110 0.82
111 0.8
112 0.8
113 0.83
114 0.82
115 0.84
116 0.8
117 0.73
118 0.72
119 0.71
120 0.73
121 0.73
122 0.77
123 0.77
124 0.8