Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BUP6

Protein Details
Accession A0A5M6BUP6   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-78AVKYRDRPGMRKKVKWQWTEFTHydrophilic
NLS Segment(s)
PositionSequence
289-293KKRKR
Subcellular Location(s) cyto 5, mito 6, nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR032563  DAMP1_SANT-like  
IPR027109  Swc4/Dmap1  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
GO:0006281  P:DNA repair  
GO:0043968  P:histone H2A acetylation  
GO:0043967  P:histone H4 acetylation  
Pfam View protein in Pfam  
PF16282  SANT_DAMP1_like  
Amino Acid Sequences MSSQDVRSILNLPQAGPSQARRAVAIVKKPDGISRELYALIGDNAPSLAEAQASLAAVKYRDRPGMRKKVKWQWTEFTPAARRDGIRLGHWARVTDRDPQDIVDYFGKFNTHGPSVMEYSQYEYDQHLVDPDWTPHETTYLFDLLRTYDLRFIVAADRYEYMGTSGIGPVKKRSVEEIKDRYYTICRRLVRTRTATDPQAQQQLIHAYAFDKARETKRKQYASELFHLTAAEIAEEEALYIEIKRMEQNERRYRADRDDLMRMVMGLDSGLVDIDQSNIETVIGVDKNKKRKRPEEEALVPSPVAPSKKQRDSAAFDIARCIYHVPPPVTNQHTSHLASKHPIHQPAHLRSTKLPLPKPTAAIRITELLNELGISAHKLVMPTRGNLEMFESLLQASGALIDMKRQVDRVEQELRTVRAQREGLVPFERKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.29
5 0.3
6 0.33
7 0.33
8 0.3
9 0.3
10 0.36
11 0.39
12 0.44
13 0.44
14 0.44
15 0.46
16 0.46
17 0.49
18 0.43
19 0.4
20 0.36
21 0.31
22 0.3
23 0.27
24 0.26
25 0.21
26 0.19
27 0.17
28 0.14
29 0.11
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.07
42 0.07
43 0.09
44 0.1
45 0.13
46 0.18
47 0.22
48 0.29
49 0.34
50 0.42
51 0.51
52 0.62
53 0.68
54 0.71
55 0.76
56 0.79
57 0.85
58 0.84
59 0.8
60 0.76
61 0.72
62 0.71
63 0.62
64 0.6
65 0.57
66 0.5
67 0.47
68 0.43
69 0.39
70 0.33
71 0.38
72 0.33
73 0.28
74 0.34
75 0.33
76 0.35
77 0.35
78 0.34
79 0.29
80 0.33
81 0.33
82 0.34
83 0.34
84 0.33
85 0.32
86 0.32
87 0.33
88 0.27
89 0.29
90 0.23
91 0.22
92 0.19
93 0.19
94 0.19
95 0.16
96 0.18
97 0.19
98 0.16
99 0.16
100 0.17
101 0.19
102 0.21
103 0.22
104 0.2
105 0.17
106 0.19
107 0.2
108 0.19
109 0.17
110 0.15
111 0.15
112 0.14
113 0.14
114 0.11
115 0.1
116 0.12
117 0.12
118 0.13
119 0.14
120 0.14
121 0.15
122 0.14
123 0.15
124 0.14
125 0.13
126 0.15
127 0.14
128 0.13
129 0.12
130 0.13
131 0.12
132 0.14
133 0.14
134 0.12
135 0.13
136 0.13
137 0.14
138 0.13
139 0.13
140 0.14
141 0.15
142 0.14
143 0.12
144 0.13
145 0.13
146 0.13
147 0.12
148 0.09
149 0.08
150 0.08
151 0.07
152 0.08
153 0.1
154 0.12
155 0.12
156 0.14
157 0.17
158 0.18
159 0.18
160 0.23
161 0.28
162 0.32
163 0.41
164 0.46
165 0.46
166 0.46
167 0.46
168 0.41
169 0.4
170 0.39
171 0.35
172 0.35
173 0.33
174 0.37
175 0.45
176 0.49
177 0.5
178 0.51
179 0.48
180 0.46
181 0.48
182 0.46
183 0.42
184 0.39
185 0.35
186 0.35
187 0.32
188 0.26
189 0.24
190 0.23
191 0.2
192 0.16
193 0.14
194 0.08
195 0.11
196 0.12
197 0.1
198 0.1
199 0.13
200 0.21
201 0.3
202 0.34
203 0.41
204 0.49
205 0.54
206 0.53
207 0.59
208 0.59
209 0.54
210 0.54
211 0.48
212 0.39
213 0.35
214 0.33
215 0.24
216 0.17
217 0.13
218 0.08
219 0.05
220 0.04
221 0.04
222 0.04
223 0.04
224 0.03
225 0.03
226 0.03
227 0.03
228 0.04
229 0.05
230 0.06
231 0.07
232 0.1
233 0.17
234 0.23
235 0.34
236 0.42
237 0.46
238 0.51
239 0.52
240 0.54
241 0.52
242 0.52
243 0.47
244 0.41
245 0.42
246 0.37
247 0.34
248 0.31
249 0.25
250 0.19
251 0.14
252 0.1
253 0.04
254 0.04
255 0.03
256 0.03
257 0.03
258 0.02
259 0.03
260 0.03
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.07
270 0.08
271 0.09
272 0.17
273 0.22
274 0.33
275 0.4
276 0.48
277 0.54
278 0.62
279 0.7
280 0.73
281 0.75
282 0.75
283 0.76
284 0.74
285 0.67
286 0.58
287 0.49
288 0.39
289 0.32
290 0.24
291 0.19
292 0.16
293 0.23
294 0.31
295 0.38
296 0.43
297 0.46
298 0.5
299 0.55
300 0.57
301 0.57
302 0.5
303 0.43
304 0.41
305 0.38
306 0.31
307 0.25
308 0.22
309 0.14
310 0.17
311 0.24
312 0.23
313 0.25
314 0.29
315 0.35
316 0.38
317 0.4
318 0.37
319 0.34
320 0.36
321 0.36
322 0.38
323 0.33
324 0.31
325 0.33
326 0.35
327 0.39
328 0.41
329 0.46
330 0.42
331 0.47
332 0.54
333 0.55
334 0.61
335 0.56
336 0.52
337 0.48
338 0.53
339 0.51
340 0.5
341 0.49
342 0.47
343 0.52
344 0.52
345 0.55
346 0.52
347 0.54
348 0.46
349 0.43
350 0.38
351 0.33
352 0.3
353 0.26
354 0.23
355 0.17
356 0.15
357 0.13
358 0.11
359 0.08
360 0.08
361 0.09
362 0.08
363 0.09
364 0.09
365 0.11
366 0.12
367 0.19
368 0.21
369 0.22
370 0.24
371 0.27
372 0.27
373 0.26
374 0.29
375 0.22
376 0.21
377 0.19
378 0.17
379 0.13
380 0.13
381 0.12
382 0.08
383 0.06
384 0.06
385 0.06
386 0.07
387 0.07
388 0.09
389 0.14
390 0.16
391 0.18
392 0.19
393 0.2
394 0.26
395 0.3
396 0.34
397 0.38
398 0.36
399 0.42
400 0.47
401 0.48
402 0.47
403 0.49
404 0.45
405 0.44
406 0.44
407 0.41
408 0.42
409 0.42
410 0.41
411 0.42
412 0.43