Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C5S2

Protein Details
Accession A0A5M6C5S2   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
392-481VFDAPSSSRPRRRSRSRSPPSHKRRERSPERERERDRYDRKDRDKGDRRDRDRNDRRERDSHRDRERDRDRERDRYRDKDGDRDRERRRHBasic
NLS Segment(s)
PositionSequence
341-362GGRGGGGRGGGGGRGGGFGGRG
400-481RPRRRSRSRSPPSHKRRERSPERERERDRYDRKDRDKGDRRDRDRNDRRERDSHRDRERDRDRERDRYRDKDGDRDRERRRH
Subcellular Location(s) cysk 7, cyto 6, mito_nucl 6, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR035542  CRIP  
IPR029000  Cyclophilin-like_dom_sf  
IPR002130  Cyclophilin-type_PPIase_dom  
IPR035538  Cyclophilin_PPIL4  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0003723  F:RNA binding  
GO:0000413  P:protein peptidyl-prolyl isomerization  
Pfam View protein in Pfam  
PF00160  Pro_isomerase  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50072  CSA_PPIASE_2  
PS50102  RRM  
CDD cd01921  cyclophilin_RRM  
cd12235  RRM_PPIL4  
Amino Acid Sequences MSVMLETSLGELVIDLEVDKCPRTCENFLKLCKIKYFALNAFFNVSKDFIAQTGDPTATGTGGESLESYLHSIAQSTSKPAPPRYFPPEILNSLKHVEKGTVSMAVSPTQPPGCGSQFFITLADGIEYLDGKHAVFGHVIEGLETLDKINEAFLDKEGRPLQDIRIRHIEILEDPFPDPPNLITPPPSPIRPPDQIASVRISDTENPYVSLPEEQAESLRRKTAQESSALTLEMIGDLPFANVRPPENILFVCKLNPVTMDEDLELIFSRFGKILSCEVVRDKKTGDSLQYAFIEFDERESAEQAYFKMQNVLVDDRRIWVDFSQSVAKMNGQFVSTSGRGGRGGGGRGGGGGRGGGFGGRGGGSGGGAGRGDAYVASTPRGAGGTEGYGMVFDAPSSSRPRRRSRSRSPPSHKRRERSPERERERDRYDRKDRDKGDRRDRDRNDRRERDSHRDRERDRDRERDRYRDKDGDRDRERRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.08
5 0.1
6 0.13
7 0.12
8 0.16
9 0.22
10 0.28
11 0.35
12 0.42
13 0.5
14 0.56
15 0.6
16 0.67
17 0.67
18 0.65
19 0.62
20 0.58
21 0.52
22 0.49
23 0.52
24 0.48
25 0.5
26 0.46
27 0.43
28 0.43
29 0.4
30 0.35
31 0.28
32 0.24
33 0.17
34 0.17
35 0.16
36 0.12
37 0.15
38 0.14
39 0.15
40 0.17
41 0.16
42 0.15
43 0.16
44 0.15
45 0.12
46 0.11
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.13
62 0.14
63 0.18
64 0.22
65 0.26
66 0.32
67 0.38
68 0.43
69 0.44
70 0.5
71 0.54
72 0.55
73 0.53
74 0.54
75 0.53
76 0.52
77 0.51
78 0.45
79 0.4
80 0.37
81 0.36
82 0.31
83 0.26
84 0.22
85 0.18
86 0.19
87 0.18
88 0.17
89 0.16
90 0.16
91 0.17
92 0.16
93 0.17
94 0.16
95 0.17
96 0.15
97 0.15
98 0.14
99 0.18
100 0.19
101 0.19
102 0.21
103 0.2
104 0.2
105 0.21
106 0.2
107 0.15
108 0.13
109 0.12
110 0.09
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.07
117 0.07
118 0.06
119 0.07
120 0.08
121 0.08
122 0.09
123 0.09
124 0.08
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.07
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.08
141 0.13
142 0.13
143 0.19
144 0.21
145 0.21
146 0.22
147 0.22
148 0.26
149 0.27
150 0.28
151 0.28
152 0.33
153 0.33
154 0.31
155 0.3
156 0.26
157 0.22
158 0.26
159 0.22
160 0.16
161 0.15
162 0.16
163 0.17
164 0.16
165 0.14
166 0.1
167 0.12
168 0.13
169 0.14
170 0.15
171 0.15
172 0.19
173 0.21
174 0.22
175 0.2
176 0.22
177 0.27
178 0.27
179 0.29
180 0.26
181 0.29
182 0.3
183 0.3
184 0.29
185 0.23
186 0.2
187 0.18
188 0.18
189 0.15
190 0.17
191 0.17
192 0.15
193 0.15
194 0.15
195 0.15
196 0.14
197 0.13
198 0.1
199 0.08
200 0.08
201 0.07
202 0.08
203 0.12
204 0.14
205 0.14
206 0.16
207 0.16
208 0.17
209 0.2
210 0.24
211 0.22
212 0.24
213 0.25
214 0.25
215 0.25
216 0.24
217 0.2
218 0.14
219 0.12
220 0.08
221 0.06
222 0.04
223 0.03
224 0.03
225 0.03
226 0.04
227 0.04
228 0.05
229 0.05
230 0.06
231 0.07
232 0.09
233 0.1
234 0.12
235 0.12
236 0.13
237 0.14
238 0.14
239 0.14
240 0.13
241 0.12
242 0.11
243 0.11
244 0.11
245 0.12
246 0.12
247 0.12
248 0.11
249 0.11
250 0.1
251 0.1
252 0.08
253 0.06
254 0.06
255 0.05
256 0.05
257 0.05
258 0.06
259 0.06
260 0.08
261 0.09
262 0.11
263 0.12
264 0.12
265 0.16
266 0.22
267 0.23
268 0.22
269 0.22
270 0.21
271 0.25
272 0.26
273 0.24
274 0.23
275 0.22
276 0.24
277 0.24
278 0.22
279 0.18
280 0.17
281 0.16
282 0.11
283 0.11
284 0.09
285 0.09
286 0.09
287 0.1
288 0.1
289 0.09
290 0.1
291 0.09
292 0.12
293 0.13
294 0.13
295 0.15
296 0.15
297 0.16
298 0.18
299 0.22
300 0.2
301 0.2
302 0.2
303 0.19
304 0.2
305 0.19
306 0.17
307 0.12
308 0.14
309 0.13
310 0.16
311 0.18
312 0.17
313 0.18
314 0.18
315 0.19
316 0.17
317 0.18
318 0.16
319 0.13
320 0.13
321 0.12
322 0.17
323 0.15
324 0.15
325 0.14
326 0.14
327 0.14
328 0.14
329 0.17
330 0.14
331 0.15
332 0.14
333 0.14
334 0.13
335 0.13
336 0.13
337 0.09
338 0.07
339 0.05
340 0.05
341 0.05
342 0.05
343 0.04
344 0.04
345 0.04
346 0.05
347 0.05
348 0.05
349 0.05
350 0.05
351 0.05
352 0.05
353 0.05
354 0.05
355 0.05
356 0.05
357 0.05
358 0.04
359 0.05
360 0.04
361 0.06
362 0.08
363 0.09
364 0.1
365 0.1
366 0.1
367 0.11
368 0.11
369 0.1
370 0.08
371 0.09
372 0.09
373 0.09
374 0.09
375 0.08
376 0.08
377 0.08
378 0.07
379 0.06
380 0.04
381 0.05
382 0.06
383 0.09
384 0.17
385 0.25
386 0.33
387 0.42
388 0.53
389 0.62
390 0.72
391 0.8
392 0.83
393 0.87
394 0.9
395 0.93
396 0.93
397 0.93
398 0.93
399 0.94
400 0.92
401 0.88
402 0.88
403 0.88
404 0.88
405 0.88
406 0.88
407 0.88
408 0.88
409 0.91
410 0.87
411 0.85
412 0.83
413 0.83
414 0.81
415 0.8
416 0.82
417 0.82
418 0.84
419 0.85
420 0.83
421 0.83
422 0.85
423 0.85
424 0.86
425 0.86
426 0.85
427 0.86
428 0.88
429 0.88
430 0.88
431 0.88
432 0.88
433 0.87
434 0.87
435 0.86
436 0.86
437 0.85
438 0.85
439 0.84
440 0.84
441 0.84
442 0.81
443 0.81
444 0.83
445 0.83
446 0.8
447 0.8
448 0.78
449 0.78
450 0.82
451 0.82
452 0.81
453 0.79
454 0.8
455 0.79
456 0.75
457 0.75
458 0.77
459 0.77
460 0.77
461 0.79