Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1UYE4

Protein Details
Accession H1UYE4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-96AAGPRKPGAKKAKKGGRYVDBasic
NLS Segment(s)
PositionSequence
80-93PRKPGAKKAKKGGR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MTPPMGRASAPPGGPPGPALGKASSQESLSVPPGASRPSSLIRSVSSTSTGGPLAGPPSRPATSMSNASSIDDLISAAGPRKPGAKKAKKGGRYVDVMAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.17
5 0.18
6 0.19
7 0.16
8 0.17
9 0.18
10 0.2
11 0.17
12 0.16
13 0.16
14 0.15
15 0.16
16 0.16
17 0.15
18 0.13
19 0.12
20 0.13
21 0.13
22 0.13
23 0.11
24 0.12
25 0.15
26 0.17
27 0.17
28 0.18
29 0.17
30 0.2
31 0.2
32 0.18
33 0.16
34 0.14
35 0.13
36 0.13
37 0.12
38 0.09
39 0.08
40 0.07
41 0.08
42 0.08
43 0.09
44 0.09
45 0.13
46 0.14
47 0.15
48 0.17
49 0.19
50 0.21
51 0.25
52 0.25
53 0.23
54 0.23
55 0.23
56 0.2
57 0.16
58 0.13
59 0.09
60 0.08
61 0.05
62 0.06
63 0.05
64 0.07
65 0.08
66 0.09
67 0.1
68 0.17
69 0.19
70 0.28
71 0.39
72 0.48
73 0.56
74 0.66
75 0.75
76 0.75
77 0.8
78 0.8
79 0.75
80 0.7