Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W191

Protein Details
Accession H1W191    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-56QQSKTQAEKDKKKRSKARVVIEHHydrophilic
NLS Segment(s)
PositionSequence
43-49DKKKRSK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025845  Thg1_C_dom  
IPR038469  tRNAHis_GuaTrfase_Thg1_sf  
Gene Ontology GO:0016779  F:nucleotidyltransferase activity  
Pfam View protein in Pfam  
PF14413  Thg1C  
Amino Acid Sequences MYKKGSVVFRDYELVEPGTHNAAEAADALAEPEQQSKTQAEKDKKKRSKARVVIEHLDIIKDDFWDRRPWLLSNKPGKTPKEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.17
4 0.16
5 0.15
6 0.14
7 0.12
8 0.1
9 0.08
10 0.08
11 0.08
12 0.06
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.05
19 0.07
20 0.07
21 0.07
22 0.1
23 0.11
24 0.13
25 0.19
26 0.26
27 0.33
28 0.43
29 0.53
30 0.62
31 0.68
32 0.76
33 0.79
34 0.81
35 0.83
36 0.82
37 0.81
38 0.79
39 0.79
40 0.72
41 0.65
42 0.58
43 0.47
44 0.38
45 0.28
46 0.2
47 0.14
48 0.11
49 0.11
50 0.11
51 0.13
52 0.19
53 0.21
54 0.24
55 0.27
56 0.29
57 0.37
58 0.43
59 0.51
60 0.55
61 0.58
62 0.63
63 0.67