Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VVU2

Protein Details
Accession H1VVU2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-77EKPSKTRSAKSPKKTKPSKTRNPGSIITHydrophilic
NLS Segment(s)
PositionSequence
49-71RAEKPSKTRSAKSPKKTKPSKTR
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MKYSFAVALSTLVLGIAAAPAANGAANSNGNGIAHAERGXFDFLHHAARAEKPSKTRSAKSPKKTKPSKTRNPGSIITSAPGAPGNGTDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.03
12 0.05
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.07
21 0.08
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.1
31 0.1
32 0.1
33 0.1
34 0.12
35 0.16
36 0.17
37 0.19
38 0.21
39 0.25
40 0.33
41 0.37
42 0.39
43 0.44
44 0.53
45 0.6
46 0.66
47 0.74
48 0.74
49 0.8
50 0.86
51 0.87
52 0.87
53 0.88
54 0.89
55 0.89
56 0.89
57 0.85
58 0.81
59 0.74
60 0.67
61 0.6
62 0.5
63 0.4
64 0.32
65 0.26
66 0.21
67 0.18
68 0.14
69 0.11