Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6C8J0

Protein Details
Accession A0A5M6C8J0   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-34RVKKDISTSHQKHRKRNLQRRLSEKVGBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.333, mito 7.5, mito_nucl 12.999, nucl 17
Family & Domain DBs
Amino Acid Sequences MAWSSVARVKKDISTSHQKHRKRNLQRRLSEKVGKLECEIAESKSIVGQLRNYIHEQEQDHLEKSQKFVSETTEGSTLYNQTFEDYSEQPEEHFIWSHQQTEAYETDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.58
4 0.65
5 0.67
6 0.72
7 0.78
8 0.81
9 0.81
10 0.86
11 0.86
12 0.87
13 0.88
14 0.86
15 0.82
16 0.79
17 0.75
18 0.68
19 0.66
20 0.58
21 0.51
22 0.44
23 0.4
24 0.32
25 0.28
26 0.25
27 0.17
28 0.16
29 0.15
30 0.13
31 0.11
32 0.13
33 0.1
34 0.1
35 0.1
36 0.13
37 0.15
38 0.17
39 0.17
40 0.17
41 0.17
42 0.19
43 0.19
44 0.16
45 0.19
46 0.18
47 0.18
48 0.18
49 0.21
50 0.18
51 0.19
52 0.21
53 0.18
54 0.18
55 0.18
56 0.21
57 0.2
58 0.2
59 0.2
60 0.19
61 0.17
62 0.17
63 0.17
64 0.14
65 0.11
66 0.12
67 0.1
68 0.1
69 0.1
70 0.11
71 0.14
72 0.14
73 0.17
74 0.19
75 0.19
76 0.18
77 0.2
78 0.2
79 0.17
80 0.18
81 0.15
82 0.21
83 0.22
84 0.24
85 0.23
86 0.24
87 0.23
88 0.26