Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VFX5

Protein Details
Accession H1VFX5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
48-70RDTSGRPGPKKRTNLPRPLWEMCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.833, cyto 7, cyto_pero 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036867  R3H_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
CDD cd02325  R3H  
Amino Acid Sequences MVFDSLGDDESASFKRWLTHSISDYYGLQSHSVTTGEPARKVVYVTVRDTSGRPGPKKRTNLPRPLWEMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.18
4 0.21
5 0.25
6 0.29
7 0.29
8 0.31
9 0.32
10 0.3
11 0.29
12 0.27
13 0.22
14 0.16
15 0.14
16 0.11
17 0.1
18 0.09
19 0.09
20 0.08
21 0.07
22 0.12
23 0.13
24 0.13
25 0.14
26 0.14
27 0.14
28 0.15
29 0.16
30 0.17
31 0.19
32 0.22
33 0.22
34 0.23
35 0.24
36 0.24
37 0.26
38 0.27
39 0.31
40 0.34
41 0.42
42 0.5
43 0.58
44 0.66
45 0.71
46 0.76
47 0.78
48 0.83
49 0.82
50 0.82