Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1UXE9

Protein Details
Accession H1UXE9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-156CWSLLDRKKAERERERERERCVCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MDNLINVAQQKAQEYLNKDDDDNKTKPQQGYGQHLPSGEKSYGGNYPAGGGAFVDDDDDDDYRHAANEASRHAGSHGDTDLFSSVLGTLTKKKTQLRNEDIDEDGMLSSLPLLSVFAYIHLSPCIPNPLIHKPCWSLLDRKKAERERERERERXCVCVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.37
4 0.37
5 0.36
6 0.4
7 0.44
8 0.46
9 0.44
10 0.43
11 0.43
12 0.48
13 0.48
14 0.46
15 0.46
16 0.45
17 0.51
18 0.53
19 0.5
20 0.45
21 0.45
22 0.42
23 0.37
24 0.36
25 0.27
26 0.2
27 0.16
28 0.17
29 0.19
30 0.19
31 0.17
32 0.12
33 0.13
34 0.12
35 0.12
36 0.09
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.09
55 0.1
56 0.14
57 0.13
58 0.13
59 0.14
60 0.14
61 0.13
62 0.12
63 0.11
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.1
76 0.14
77 0.16
78 0.21
79 0.27
80 0.34
81 0.42
82 0.51
83 0.53
84 0.56
85 0.57
86 0.55
87 0.5
88 0.42
89 0.34
90 0.24
91 0.17
92 0.11
93 0.07
94 0.05
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.05
103 0.05
104 0.08
105 0.08
106 0.09
107 0.09
108 0.1
109 0.09
110 0.11
111 0.15
112 0.14
113 0.16
114 0.21
115 0.31
116 0.35
117 0.36
118 0.39
119 0.37
120 0.4
121 0.42
122 0.4
123 0.4
124 0.44
125 0.53
126 0.55
127 0.59
128 0.65
129 0.69
130 0.77
131 0.77
132 0.77
133 0.77
134 0.82
135 0.85
136 0.82
137 0.82
138 0.79