Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6CBU1

Protein Details
Accession A0A5M6CBU1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-125EEKEEEKKEEKKEEKKEEKKEEKKDKKSAcidic
NLS Segment(s)
PositionSequence
82-125KKEEEKKEVEKKEEKKEEKEEEKKEEKKEEKKEEKKEEKKDKKS
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MEGTDLSKATEGLTSAKQRADTLKKWFDIPSSQLSKKLEKQMAEMAESIKSLKGSTVATTSAETKTDAASTQTSSDGGGGEKKEEEKKEVEKKEEKKEEKEEEKKEEKKEEKKEEKKEEKKDKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.26
4 0.26
5 0.27
6 0.35
7 0.39
8 0.39
9 0.43
10 0.48
11 0.47
12 0.48
13 0.47
14 0.42
15 0.38
16 0.36
17 0.35
18 0.35
19 0.35
20 0.38
21 0.4
22 0.43
23 0.45
24 0.5
25 0.46
26 0.39
27 0.41
28 0.42
29 0.4
30 0.36
31 0.3
32 0.22
33 0.18
34 0.17
35 0.15
36 0.1
37 0.09
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.09
44 0.09
45 0.1
46 0.1
47 0.12
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.09
61 0.08
62 0.08
63 0.07
64 0.07
65 0.09
66 0.08
67 0.09
68 0.1
69 0.13
70 0.18
71 0.19
72 0.22
73 0.24
74 0.32
75 0.41
76 0.45
77 0.5
78 0.54
79 0.6
80 0.67
81 0.73
82 0.7
83 0.68
84 0.71
85 0.73
86 0.75
87 0.77
88 0.73
89 0.71
90 0.75
91 0.75
92 0.72
93 0.73
94 0.72
95 0.73
96 0.77
97 0.79
98 0.81
99 0.84
100 0.88
101 0.89
102 0.91
103 0.91
104 0.91
105 0.92