Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VS66

Protein Details
Accession H1VS66    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
72-91HVDMRIRKRRLQSKESKVYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MSSRRSAMFKEEEWARVQPIIRKLYLLEDKSLKDVVTILSTFHNFRPSKAQLESKLRQWHMAKNMTSMEWKHVDMRIRKRRLQSKESKVYLSGIPLRIHGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.28
4 0.29
5 0.29
6 0.33
7 0.35
8 0.31
9 0.3
10 0.29
11 0.34
12 0.39
13 0.34
14 0.3
15 0.3
16 0.3
17 0.32
18 0.32
19 0.24
20 0.16
21 0.15
22 0.12
23 0.11
24 0.11
25 0.09
26 0.1
27 0.12
28 0.13
29 0.13
30 0.21
31 0.18
32 0.19
33 0.26
34 0.27
35 0.3
36 0.31
37 0.35
38 0.32
39 0.41
40 0.42
41 0.41
42 0.46
43 0.42
44 0.45
45 0.43
46 0.43
47 0.42
48 0.46
49 0.4
50 0.36
51 0.37
52 0.31
53 0.32
54 0.27
55 0.24
56 0.2
57 0.2
58 0.2
59 0.22
60 0.29
61 0.34
62 0.44
63 0.5
64 0.55
65 0.6
66 0.68
67 0.74
68 0.75
69 0.77
70 0.77
71 0.78
72 0.81
73 0.78
74 0.71
75 0.63
76 0.57
77 0.48
78 0.44
79 0.39
80 0.34
81 0.31