Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6C686

Protein Details
Accession A0A5M6C686    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPATPKSTPTKPKAKPYDRTSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.833, nucl 8.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MPATPKSTPTKPKAKPYDRTSTSPSSDISDTKPDLTTPTKSKTKMNKNSVSPRQPRPWTNEELGQLFEHVLKSSTLGMKGFEGAVEGRNANQCYQSWMNTLAPFLKKAIATKGGKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.8
4 0.83
5 0.77
6 0.75
7 0.71
8 0.66
9 0.6
10 0.52
11 0.45
12 0.38
13 0.34
14 0.3
15 0.27
16 0.26
17 0.24
18 0.23
19 0.23
20 0.19
21 0.22
22 0.24
23 0.26
24 0.25
25 0.31
26 0.35
27 0.37
28 0.44
29 0.5
30 0.58
31 0.63
32 0.67
33 0.67
34 0.7
35 0.78
36 0.79
37 0.78
38 0.73
39 0.7
40 0.69
41 0.67
42 0.62
43 0.59
44 0.56
45 0.5
46 0.46
47 0.42
48 0.36
49 0.31
50 0.29
51 0.22
52 0.17
53 0.13
54 0.12
55 0.09
56 0.07
57 0.07
58 0.06
59 0.07
60 0.09
61 0.1
62 0.11
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.07
71 0.08
72 0.09
73 0.09
74 0.1
75 0.15
76 0.16
77 0.16
78 0.17
79 0.16
80 0.22
81 0.25
82 0.25
83 0.22
84 0.25
85 0.27
86 0.26
87 0.27
88 0.25
89 0.25
90 0.24
91 0.23
92 0.23
93 0.21
94 0.23
95 0.28
96 0.32
97 0.33