Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U7X5

Protein Details
Accession Q6U7X5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-69SFCLRSRLRSRSKGRNRRKEREGKEKHRSLFBasic
NLS Segment(s)
PositionSequence
45-66RLRSRSKGRNRRKEREGKEKHR
Subcellular Location(s) extr 7, mito 5, plas 5, E.R. 4, golg 4
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MFIILGIILLFIFVTLLAPAPLLRFPPPPLPASPCSAPSFCLRSRLRSRSKGRNRRKEREGKEKHRSLFPLPAPSASCMLPSPCEAGKESKQPQEEKEALPLLLHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.04
5 0.05
6 0.05
7 0.06
8 0.07
9 0.09
10 0.11
11 0.13
12 0.16
13 0.23
14 0.25
15 0.26
16 0.28
17 0.32
18 0.31
19 0.34
20 0.33
21 0.29
22 0.3
23 0.28
24 0.27
25 0.25
26 0.28
27 0.23
28 0.31
29 0.29
30 0.34
31 0.42
32 0.5
33 0.54
34 0.59
35 0.65
36 0.67
37 0.77
38 0.8
39 0.82
40 0.85
41 0.86
42 0.85
43 0.88
44 0.87
45 0.84
46 0.84
47 0.84
48 0.83
49 0.83
50 0.81
51 0.74
52 0.69
53 0.64
54 0.56
55 0.53
56 0.46
57 0.44
58 0.38
59 0.37
60 0.34
61 0.32
62 0.3
63 0.22
64 0.2
65 0.14
66 0.14
67 0.14
68 0.14
69 0.16
70 0.15
71 0.16
72 0.17
73 0.23
74 0.27
75 0.35
76 0.4
77 0.43
78 0.48
79 0.5
80 0.51
81 0.54
82 0.53
83 0.45
84 0.46
85 0.41
86 0.35