FuNGI

A0A5M6C0E0

Protein Details

Accession

A0A5M6C0E0

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
5-30	DLCEDVPHKKRGRPKVPKPALGEPYH	Basic

NLS Segment(s)

Position	Sequence
12-26	HKKRGRPKVPKPALG

Subcellular Location(s)

nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR000014 PAS IPR035965 PAS-like_dom_sf
PROSITE	View protein in PROSITE PS50112 PAS
CDD	cd00130 PAS

Amino Acid Sequences

MGKEDLCEDVPHKKRGRPKVPKPALGEPYHRAKQPAPADSGGVGKWKGPSAYDAPYMTTVDAPPPPMALPIVRGIPSAPRLEGEQGYPPAVPPTQPFTLFTTTDFKILRASPTCYPLIGYHPNEFVNLNLLDWIHPQDRHFIDMERNRLLTVPYVEGPLRSTDVTQAAITQRSELELLSPAEGMREPYPNKNVRVLHSDTRFSPFNVRLHLGGGLGASLWQPATLSRIYLVISFLAIPARPAAPDMPQPPSRRTSQIAPPTPVTPVPSMPGQGLPGFSSIAAAADAPQPRYDNQLPPQSYYPPPQPPSGSRPGPSQTAYPYSRPGAPPNASSIYGGAGGVGVGGRRSSSPSAAYRTPQSSTYPMNTPDYPHAQALPPQTGYYPPPPEAYRRPSDEEQWRNANSNGNGSGGMGSAARGGVLPPPPGSGGIPPSGDGARRAWEL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.59
2	0.67
3	0.76
4	0.77
5	0.81
6	0.84
7	0.88
8	0.9
9	0.87
10	0.86
11	0.82
12	0.77
13	0.72
14	0.67
15	0.66
16	0.63
17	0.58
18	0.52
19	0.46
20	0.49
21	0.51
22	0.51
23	0.47
24	0.43
25	0.42
26	0.4
27	0.4
28	0.31
29	0.27
30	0.21
31	0.18
32	0.19
33	0.2
34	0.2
35	0.19
36	0.23
37	0.23
38	0.27
39	0.3
40	0.28
41	0.28
42	0.29
43	0.28
44	0.24
45	0.21
46	0.17
47	0.17
48	0.17
49	0.18
50	0.16
51	0.16
52	0.16
53	0.15
54	0.16
55	0.12
56	0.13
57	0.14
58	0.16
59	0.15
60	0.15
61	0.15
62	0.18
63	0.22
64	0.21
65	0.19
66	0.17
67	0.19
68	0.22
69	0.23
70	0.21
71	0.23
72	0.22
73	0.23
74	0.22
75	0.2
76	0.19
77	0.19
78	0.18
79	0.15
80	0.19
81	0.21
82	0.22
83	0.24
84	0.25
85	0.29
86	0.28
87	0.28
88	0.27
89	0.25
90	0.29
91	0.27
92	0.23
93	0.22
94	0.23
95	0.27
96	0.25
97	0.28
98	0.27
99	0.3
100	0.31
101	0.27
102	0.27
103	0.22
104	0.25
105	0.29
106	0.29
107	0.27
108	0.29
109	0.29
110	0.29
111	0.27
112	0.21
113	0.18
114	0.15
115	0.12
116	0.11
117	0.11
118	0.1
119	0.11
120	0.15
121	0.13
122	0.15
123	0.15
124	0.22
125	0.22
126	0.24
127	0.24
128	0.22
129	0.28
130	0.32
131	0.36
132	0.31
133	0.3
134	0.28
135	0.28
136	0.27
137	0.21
138	0.18
139	0.15
140	0.13
141	0.15
142	0.15
143	0.15
144	0.15
145	0.13
146	0.13
147	0.11
148	0.11
149	0.11
150	0.12
151	0.13
152	0.12
153	0.13
154	0.13
155	0.15
156	0.14
157	0.13
158	0.12
159	0.11
160	0.12
161	0.09
162	0.09
163	0.09
164	0.1
165	0.09
166	0.09
167	0.08
168	0.09
169	0.09
170	0.1
171	0.09
172	0.13
173	0.15
174	0.19
175	0.26
176	0.3
177	0.32
178	0.36
179	0.37
180	0.35
181	0.39
182	0.4
183	0.39
184	0.37
185	0.37
186	0.32
187	0.34
188	0.32
189	0.27
190	0.27
191	0.25
192	0.24
193	0.24
194	0.25
195	0.21
196	0.21
197	0.21
198	0.15
199	0.11
200	0.09
201	0.06
202	0.05
203	0.05
204	0.04
205	0.03
206	0.03
207	0.03
208	0.03
209	0.03
210	0.06
211	0.06
212	0.06
213	0.06
214	0.07
215	0.07
216	0.08
217	0.08
218	0.06
219	0.06
220	0.06
221	0.05
222	0.05
223	0.05
224	0.05
225	0.05
226	0.05
227	0.05
228	0.06
229	0.07
230	0.08
231	0.12
232	0.14
233	0.19
234	0.24
235	0.27
236	0.29
237	0.32
238	0.33
239	0.32
240	0.33
241	0.33
242	0.36
243	0.43
244	0.44
245	0.44
246	0.43
247	0.4
248	0.38
249	0.34
250	0.28
251	0.2
252	0.15
253	0.15
254	0.14
255	0.14
256	0.13
257	0.13
258	0.11
259	0.11
260	0.11
261	0.09
262	0.09
263	0.09
264	0.08
265	0.07
266	0.06
267	0.06
268	0.05
269	0.05
270	0.05
271	0.09
272	0.11
273	0.11
274	0.12
275	0.13
276	0.14
277	0.21
278	0.24
279	0.25
280	0.3
281	0.38
282	0.38
283	0.4
284	0.42
285	0.39
286	0.38
287	0.37
288	0.38
289	0.37
290	0.38
291	0.39
292	0.4
293	0.4
294	0.44
295	0.48
296	0.45
297	0.39
298	0.41
299	0.41
300	0.41
301	0.37
302	0.32
303	0.28
304	0.31
305	0.32
306	0.3
307	0.3
308	0.29
309	0.32
310	0.32
311	0.33
312	0.33
313	0.33
314	0.32
315	0.34
316	0.34
317	0.31
318	0.29
319	0.25
320	0.18
321	0.16
322	0.14
323	0.09
324	0.06
325	0.05
326	0.05
327	0.05
328	0.04
329	0.04
330	0.04
331	0.05
332	0.05
333	0.1
334	0.11
335	0.13
336	0.18
337	0.22
338	0.28
339	0.3
340	0.32
341	0.34
342	0.35
343	0.35
344	0.33
345	0.32
346	0.31
347	0.33
348	0.34
349	0.33
350	0.33
351	0.36
352	0.35
353	0.35
354	0.36
355	0.37
356	0.36
357	0.32
358	0.31
359	0.28
360	0.32
361	0.33
362	0.31
363	0.27
364	0.25
365	0.24
366	0.25
367	0.28
368	0.31
369	0.31
370	0.28
371	0.32
372	0.34
373	0.4
374	0.46
375	0.49
376	0.49
377	0.5
378	0.56
379	0.55
380	0.62
381	0.65
382	0.64
383	0.63
384	0.63
385	0.6
386	0.56
387	0.54
388	0.54
389	0.45
390	0.43
391	0.37
392	0.31
393	0.28
394	0.25
395	0.23
396	0.15
397	0.14
398	0.08
399	0.07
400	0.07
401	0.07
402	0.06
403	0.06
404	0.06
405	0.11
406	0.14
407	0.16
408	0.16
409	0.18
410	0.19
411	0.2
412	0.21
413	0.2
414	0.21
415	0.22
416	0.22
417	0.21
418	0.23
419	0.23
420	0.23
421	0.22
422	0.2

A0A5M6C0E0

3D AlphaFold-predicted Structure Viewer