Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VZU3

Protein Details
Accession H1VZU3    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
375-394VPVEKLSRKRRWTWRTWEFDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_pero 9.5, nucl 5, pero 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014756  Ig_E-set  
IPR005066  MoCF_OxRdtse_dimer  
IPR008335  Mopterin_OxRdtase_euk  
IPR000572  OxRdtase_Mopterin-bd_dom  
IPR036374  OxRdtase_Mopterin-bd_sf  
Gene Ontology GO:0030151  F:molybdenum ion binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF03404  Mo-co_dimer  
PF00174  Oxidored_molyb  
CDD cd02110  SO_family_Moco_dimer  
Amino Acid Sequences NVASFVEWENYPAKKAAAHKILTSQTFPPNPEFQLGPIPATNPVLPGTHWKMWHHAVGGELDRVPDDSWDIVQKEKHPDMLHLLQFPYNGEPPKRLVTDQEITPNPLHFVRNHGGIPIIDRRDYSFLLDGLVAEPRSFTLDDIMDESRFPRMEKTVTMQCSGTRRIEQILKYAGQGDEVPQAPWAEGAIGTARYVGISLKKVVKACGGLAEGAKHLEFYGADTYFKDDKTMNYLVSVPWAKVKANEVMLAWEMNGEPLPRIHGYPLRIVVFGYIGARSVKWLYRVKAIREPSRAPVQSQEYLYFPQQVGKHNLKMTDGIQIQEMPVSSAIMSPWTKQVVIHNGSIRCKGWAYSGGGRWPERVELSADGGFNWYAVPVEKLSRKRRWTWRTWEFDLPCDVEGWVEVVCRCWDNALNTQPPDVRTAWNWGLHVTSSCHRISLYSVNKSRPATRARLAEFESKGIPFGPITVPLAFPSQSWEDYEKYWASHDPRDAEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.37
4 0.41
5 0.42
6 0.42
7 0.48
8 0.53
9 0.51
10 0.48
11 0.43
12 0.43
13 0.45
14 0.45
15 0.43
16 0.42
17 0.4
18 0.4
19 0.36
20 0.29
21 0.33
22 0.32
23 0.29
24 0.25
25 0.24
26 0.24
27 0.26
28 0.24
29 0.17
30 0.18
31 0.16
32 0.16
33 0.23
34 0.29
35 0.3
36 0.34
37 0.34
38 0.39
39 0.42
40 0.45
41 0.38
42 0.31
43 0.28
44 0.29
45 0.29
46 0.26
47 0.22
48 0.19
49 0.17
50 0.17
51 0.16
52 0.12
53 0.12
54 0.11
55 0.12
56 0.17
57 0.17
58 0.2
59 0.23
60 0.27
61 0.34
62 0.35
63 0.39
64 0.35
65 0.36
66 0.4
67 0.44
68 0.42
69 0.37
70 0.36
71 0.32
72 0.31
73 0.3
74 0.26
75 0.24
76 0.25
77 0.24
78 0.25
79 0.28
80 0.33
81 0.34
82 0.31
83 0.31
84 0.33
85 0.36
86 0.36
87 0.41
88 0.36
89 0.37
90 0.38
91 0.34
92 0.29
93 0.26
94 0.26
95 0.18
96 0.24
97 0.23
98 0.26
99 0.25
100 0.24
101 0.23
102 0.21
103 0.25
104 0.25
105 0.24
106 0.21
107 0.21
108 0.23
109 0.25
110 0.26
111 0.24
112 0.19
113 0.17
114 0.17
115 0.16
116 0.14
117 0.11
118 0.13
119 0.1
120 0.08
121 0.08
122 0.08
123 0.1
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.14
130 0.15
131 0.13
132 0.13
133 0.13
134 0.14
135 0.14
136 0.13
137 0.13
138 0.15
139 0.17
140 0.19
141 0.24
142 0.28
143 0.3
144 0.31
145 0.29
146 0.28
147 0.31
148 0.33
149 0.3
150 0.25
151 0.24
152 0.27
153 0.31
154 0.29
155 0.29
156 0.29
157 0.27
158 0.25
159 0.26
160 0.22
161 0.18
162 0.17
163 0.14
164 0.14
165 0.14
166 0.14
167 0.12
168 0.12
169 0.11
170 0.11
171 0.09
172 0.06
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.05
180 0.05
181 0.05
182 0.06
183 0.07
184 0.09
185 0.12
186 0.15
187 0.18
188 0.19
189 0.2
190 0.21
191 0.19
192 0.18
193 0.17
194 0.15
195 0.13
196 0.12
197 0.12
198 0.1
199 0.1
200 0.1
201 0.07
202 0.06
203 0.06
204 0.05
205 0.06
206 0.09
207 0.09
208 0.1
209 0.1
210 0.14
211 0.15
212 0.15
213 0.15
214 0.12
215 0.12
216 0.18
217 0.19
218 0.15
219 0.15
220 0.15
221 0.14
222 0.17
223 0.17
224 0.11
225 0.12
226 0.13
227 0.13
228 0.13
229 0.16
230 0.15
231 0.15
232 0.16
233 0.13
234 0.13
235 0.14
236 0.12
237 0.1
238 0.07
239 0.06
240 0.05
241 0.05
242 0.05
243 0.04
244 0.05
245 0.07
246 0.07
247 0.08
248 0.1
249 0.12
250 0.14
251 0.16
252 0.19
253 0.18
254 0.17
255 0.17
256 0.15
257 0.12
258 0.11
259 0.09
260 0.06
261 0.06
262 0.06
263 0.06
264 0.07
265 0.08
266 0.09
267 0.15
268 0.2
269 0.2
270 0.29
271 0.33
272 0.36
273 0.41
274 0.46
275 0.46
276 0.47
277 0.48
278 0.44
279 0.48
280 0.45
281 0.39
282 0.38
283 0.36
284 0.34
285 0.33
286 0.3
287 0.23
288 0.24
289 0.24
290 0.21
291 0.16
292 0.18
293 0.19
294 0.22
295 0.28
296 0.3
297 0.34
298 0.33
299 0.34
300 0.3
301 0.3
302 0.26
303 0.26
304 0.23
305 0.19
306 0.18
307 0.17
308 0.16
309 0.15
310 0.14
311 0.07
312 0.07
313 0.06
314 0.06
315 0.06
316 0.06
317 0.09
318 0.1
319 0.1
320 0.13
321 0.14
322 0.14
323 0.15
324 0.2
325 0.24
326 0.27
327 0.3
328 0.33
329 0.35
330 0.37
331 0.39
332 0.34
333 0.27
334 0.25
335 0.21
336 0.19
337 0.2
338 0.23
339 0.26
340 0.29
341 0.31
342 0.35
343 0.35
344 0.33
345 0.3
346 0.26
347 0.22
348 0.2
349 0.18
350 0.15
351 0.18
352 0.18
353 0.17
354 0.15
355 0.16
356 0.14
357 0.12
358 0.1
359 0.07
360 0.06
361 0.06
362 0.08
363 0.08
364 0.13
365 0.2
366 0.29
367 0.38
368 0.47
369 0.53
370 0.61
371 0.71
372 0.75
373 0.78
374 0.79
375 0.8
376 0.8
377 0.79
378 0.79
379 0.69
380 0.63
381 0.57
382 0.48
383 0.38
384 0.3
385 0.25
386 0.15
387 0.14
388 0.12
389 0.08
390 0.08
391 0.08
392 0.09
393 0.11
394 0.11
395 0.11
396 0.13
397 0.16
398 0.2
399 0.27
400 0.33
401 0.37
402 0.37
403 0.41
404 0.41
405 0.38
406 0.38
407 0.32
408 0.28
409 0.23
410 0.3
411 0.32
412 0.32
413 0.31
414 0.28
415 0.27
416 0.25
417 0.25
418 0.22
419 0.21
420 0.23
421 0.22
422 0.22
423 0.21
424 0.21
425 0.23
426 0.29
427 0.34
428 0.39
429 0.44
430 0.48
431 0.54
432 0.56
433 0.57
434 0.54
435 0.53
436 0.51
437 0.52
438 0.56
439 0.54
440 0.57
441 0.56
442 0.57
443 0.51
444 0.47
445 0.43
446 0.34
447 0.31
448 0.26
449 0.23
450 0.14
451 0.15
452 0.14
453 0.15
454 0.17
455 0.18
456 0.18
457 0.18
458 0.21
459 0.18
460 0.17
461 0.2
462 0.2
463 0.21
464 0.24
465 0.26
466 0.25
467 0.26
468 0.32
469 0.28
470 0.25
471 0.27
472 0.3
473 0.32
474 0.37
475 0.42
476 0.4