Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M6BXP6

Protein Details
Accession A0A5M6BXP6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
235-254IEEEKKRKRAEKFGTIKPASBasic
NLS Segment(s)
PositionSequence
238-246EKKRKRAEK
Subcellular Location(s) cyto_nucl 9.833, mito 8.5, mito_nucl 12.666, nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
Pfam View protein in Pfam  
PF02037  SAP  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MEAKLQKLKVTELKELLAKHHLVQTGKKDDLVKRLLDNNVSVEDGPEEELVDPDASTGGTAAPPSGPAVTAAPAAPEPVSTSQEASSSDATTTALEPTPTPINDTLTPEQQAMKARAERFGIPFNPDAKPKSSSKPKSSAAAASPAPTAPAAAAAPAPTQPPKQKAGAIDSNPLGLSEEVLARRAAKFGLPEKKAEPVKPAAATDAAPAPTPAAKKVEEKPKEEISPELAEKIAIEEEKKRKRAEKFGTIKPASEPAAANGTNGSSEPDAKKAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.39
4 0.37
5 0.33
6 0.28
7 0.31
8 0.32
9 0.31
10 0.37
11 0.42
12 0.44
13 0.43
14 0.44
15 0.46
16 0.45
17 0.51
18 0.49
19 0.42
20 0.39
21 0.44
22 0.44
23 0.4
24 0.37
25 0.31
26 0.28
27 0.27
28 0.23
29 0.17
30 0.15
31 0.13
32 0.13
33 0.1
34 0.09
35 0.08
36 0.09
37 0.09
38 0.09
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.07
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.08
61 0.09
62 0.08
63 0.07
64 0.09
65 0.1
66 0.13
67 0.12
68 0.14
69 0.13
70 0.15
71 0.16
72 0.15
73 0.14
74 0.13
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.08
82 0.08
83 0.08
84 0.11
85 0.13
86 0.13
87 0.15
88 0.14
89 0.17
90 0.18
91 0.24
92 0.23
93 0.22
94 0.23
95 0.21
96 0.21
97 0.2
98 0.22
99 0.19
100 0.21
101 0.23
102 0.23
103 0.25
104 0.26
105 0.26
106 0.24
107 0.26
108 0.23
109 0.21
110 0.23
111 0.23
112 0.23
113 0.23
114 0.23
115 0.21
116 0.24
117 0.24
118 0.29
119 0.37
120 0.43
121 0.46
122 0.51
123 0.5
124 0.49
125 0.48
126 0.43
127 0.33
128 0.3
129 0.25
130 0.19
131 0.17
132 0.14
133 0.13
134 0.1
135 0.09
136 0.05
137 0.06
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.06
144 0.07
145 0.08
146 0.12
147 0.16
148 0.2
149 0.22
150 0.24
151 0.26
152 0.27
153 0.32
154 0.35
155 0.32
156 0.32
157 0.29
158 0.28
159 0.25
160 0.23
161 0.17
162 0.1
163 0.09
164 0.06
165 0.08
166 0.08
167 0.09
168 0.1
169 0.09
170 0.1
171 0.1
172 0.1
173 0.09
174 0.13
175 0.19
176 0.28
177 0.29
178 0.31
179 0.32
180 0.39
181 0.42
182 0.39
183 0.36
184 0.32
185 0.34
186 0.33
187 0.32
188 0.26
189 0.23
190 0.22
191 0.19
192 0.18
193 0.14
194 0.13
195 0.13
196 0.12
197 0.13
198 0.14
199 0.15
200 0.15
201 0.17
202 0.22
203 0.3
204 0.4
205 0.43
206 0.46
207 0.5
208 0.54
209 0.54
210 0.5
211 0.45
212 0.39
213 0.38
214 0.34
215 0.29
216 0.23
217 0.2
218 0.18
219 0.18
220 0.16
221 0.12
222 0.13
223 0.2
224 0.31
225 0.4
226 0.45
227 0.49
228 0.55
229 0.62
230 0.7
231 0.71
232 0.72
233 0.71
234 0.75
235 0.8
236 0.74
237 0.67
238 0.59
239 0.54
240 0.46
241 0.4
242 0.32
243 0.24
244 0.29
245 0.28
246 0.25
247 0.21
248 0.19
249 0.17
250 0.16
251 0.17
252 0.12
253 0.17
254 0.19
255 0.26