Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6C2F8

Protein Details
Accession A0A5M6C2F8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
234-253EEEDERRKRRRDREILQGVEAcidic
NLS Segment(s)
PositionSequence
239-244RRKRRR
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MPIGPSLPPHLAHLAASRSPSPPGPSLGPPGPAAEEEDEDDYVPALPPHLAAARGNKGAAPSLGPSIGPSAPTVGPSIGPSIPTVGPTLPPTTAGPSRPPPSYLNQYDDDSDDDVIGPRPVPTAGGEEEAGSAIREFMEREERRRKDAEEASKPQVRKREEWMLVPPTSGVLSNVDPLRKRPTTFSKSTAEPSDIDNTLWTETPAEKAQRIADEVAGVKRKKDKAGERIVSYEEEEDERRKRRRDREILQGVEKHTASQRGPSLLDKHAAKLSQKKKEGKEDEAPGIWDHDRDMGITGRLLSEQERKAKIKDARGLGDRFGHGKSGAFSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.27
4 0.26
5 0.25
6 0.27
7 0.29
8 0.29
9 0.27
10 0.29
11 0.3
12 0.31
13 0.37
14 0.36
15 0.36
16 0.32
17 0.3
18 0.27
19 0.24
20 0.24
21 0.19
22 0.17
23 0.17
24 0.18
25 0.17
26 0.16
27 0.15
28 0.13
29 0.11
30 0.11
31 0.09
32 0.08
33 0.07
34 0.07
35 0.09
36 0.1
37 0.11
38 0.13
39 0.2
40 0.24
41 0.25
42 0.25
43 0.24
44 0.23
45 0.23
46 0.21
47 0.16
48 0.13
49 0.13
50 0.13
51 0.12
52 0.12
53 0.14
54 0.13
55 0.12
56 0.11
57 0.13
58 0.12
59 0.13
60 0.14
61 0.11
62 0.11
63 0.11
64 0.14
65 0.11
66 0.12
67 0.11
68 0.13
69 0.13
70 0.13
71 0.14
72 0.11
73 0.12
74 0.14
75 0.15
76 0.12
77 0.14
78 0.14
79 0.17
80 0.2
81 0.2
82 0.23
83 0.28
84 0.31
85 0.31
86 0.33
87 0.31
88 0.34
89 0.41
90 0.4
91 0.38
92 0.37
93 0.37
94 0.35
95 0.33
96 0.29
97 0.21
98 0.17
99 0.13
100 0.1
101 0.1
102 0.1
103 0.09
104 0.08
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.1
111 0.1
112 0.11
113 0.11
114 0.11
115 0.11
116 0.1
117 0.09
118 0.06
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.06
125 0.16
126 0.18
127 0.25
128 0.35
129 0.37
130 0.41
131 0.43
132 0.43
133 0.41
134 0.47
135 0.49
136 0.47
137 0.51
138 0.52
139 0.54
140 0.53
141 0.48
142 0.48
143 0.42
144 0.36
145 0.37
146 0.41
147 0.39
148 0.4
149 0.42
150 0.4
151 0.36
152 0.33
153 0.27
154 0.18
155 0.16
156 0.14
157 0.09
158 0.06
159 0.07
160 0.09
161 0.11
162 0.13
163 0.13
164 0.15
165 0.22
166 0.22
167 0.22
168 0.26
169 0.34
170 0.39
171 0.42
172 0.45
173 0.42
174 0.42
175 0.44
176 0.4
177 0.32
178 0.26
179 0.24
180 0.23
181 0.2
182 0.18
183 0.15
184 0.14
185 0.13
186 0.12
187 0.1
188 0.08
189 0.08
190 0.11
191 0.13
192 0.14
193 0.14
194 0.15
195 0.17
196 0.16
197 0.18
198 0.16
199 0.13
200 0.13
201 0.14
202 0.16
203 0.21
204 0.2
205 0.21
206 0.28
207 0.3
208 0.34
209 0.41
210 0.46
211 0.49
212 0.59
213 0.62
214 0.57
215 0.56
216 0.53
217 0.46
218 0.38
219 0.29
220 0.19
221 0.16
222 0.16
223 0.19
224 0.23
225 0.31
226 0.37
227 0.44
228 0.53
229 0.6
230 0.7
231 0.76
232 0.75
233 0.78
234 0.81
235 0.78
236 0.74
237 0.68
238 0.58
239 0.53
240 0.46
241 0.37
242 0.3
243 0.3
244 0.26
245 0.27
246 0.28
247 0.26
248 0.28
249 0.3
250 0.32
251 0.29
252 0.35
253 0.3
254 0.3
255 0.31
256 0.32
257 0.33
258 0.39
259 0.46
260 0.5
261 0.57
262 0.63
263 0.67
264 0.75
265 0.76
266 0.74
267 0.73
268 0.69
269 0.65
270 0.58
271 0.53
272 0.42
273 0.39
274 0.32
275 0.24
276 0.18
277 0.16
278 0.15
279 0.14
280 0.16
281 0.14
282 0.15
283 0.15
284 0.15
285 0.13
286 0.13
287 0.14
288 0.15
289 0.21
290 0.26
291 0.34
292 0.4
293 0.43
294 0.45
295 0.53
296 0.56
297 0.58
298 0.6
299 0.59
300 0.59
301 0.63
302 0.63
303 0.57
304 0.54
305 0.48
306 0.42
307 0.36
308 0.31
309 0.25
310 0.24