Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M6BT00

Protein Details
Accession A0A5M6BT00    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-46AHIPIVKKRTKVFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKVFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPAHIPIVKKRTKVFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTKHLLPSGHKELLVHNLSELELLLMHSGKYAASIAHGVSSKKRIEIIARAKVLGVKVTNAAAKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.81
4 0.86
5 0.87
6 0.85
7 0.82
8 0.81
9 0.77
10 0.7
11 0.61
12 0.55
13 0.55
14 0.56
15 0.58
16 0.59
17 0.55
18 0.52
19 0.53
20 0.58
21 0.61
22 0.62
23 0.62
24 0.63
25 0.71
26 0.8
27 0.84
28 0.77
29 0.74
30 0.71
31 0.68
32 0.67
33 0.64
34 0.64
35 0.64
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.4
46 0.41
47 0.44
48 0.44
49 0.43
50 0.43
51 0.42
52 0.39
53 0.46
54 0.5
55 0.47
56 0.45
57 0.39
58 0.34
59 0.34
60 0.28
61 0.2
62 0.14
63 0.13
64 0.13
65 0.13
66 0.12
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.07
81 0.07
82 0.09
83 0.11
84 0.12
85 0.15
86 0.2
87 0.21
88 0.21
89 0.22
90 0.22
91 0.25
92 0.33
93 0.39
94 0.42
95 0.43
96 0.42
97 0.41
98 0.41
99 0.37
100 0.32
101 0.24
102 0.17
103 0.17
104 0.19
105 0.21
106 0.2
107 0.21
108 0.19
109 0.19